BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_H22 (477 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 25 0.36 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.1 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 1.1 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 1.1 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 1.1 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 1.1 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 1.1 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 1.1 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 1.1 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 1.1 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 1.1 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 22 3.3 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 3.3 AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esteras... 21 4.4 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 5.8 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 25.0 bits (52), Expect = 0.36 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +3 Query: 93 HSTPGSS*NGPYPRWISAWTSRGCQGFGQEASCPMC 200 ++ PG+S + + W S W ++G + C C Sbjct: 348 NAAPGNSASNRHSAWQSHWLNKGAEQAKNVLKCVWC 383 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 1.1 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +2 Query: 149 DFTRLPRLWTRGKLSYVYWLRTVTRQPT 232 D+T P W + +W T TR+ T Sbjct: 1034 DWTTKPSTWWSSTTTSPWWTTTTTRRTT 1061 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.4 bits (48), Expect = 1.1 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -2 Query: 419 STSNAGVSSPKSLITTQEQP--TIFLALPSLS 330 STS+ GV+SP+ L T P T L+ PS S Sbjct: 104 STSSTGVASPQDLSTNGAPPRSTPPLSTPSNS 135 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.4 bits (48), Expect = 1.1 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -2 Query: 419 STSNAGVSSPKSLITTQEQP--TIFLALPSLS 330 STS+ GV+SP+ L T P T L+ PS S Sbjct: 104 STSSTGVASPQDLSTNGAPPRSTPPLSTPSNS 135 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 23.4 bits (48), Expect = 1.1 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -2 Query: 419 STSNAGVSSPKSLITTQEQP--TIFLALPSLS 330 STS+ GV+SP+ L T P T L+ PS S Sbjct: 104 STSSTGVASPQDLSTNGAPPRSTPPLSTPSNS 135 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.4 bits (48), Expect = 1.1 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -2 Query: 419 STSNAGVSSPKSLITTQEQP--TIFLALPSLS 330 STS+ GV+SP+ L T P T L+ PS S Sbjct: 104 STSSTGVASPQDLSTNGAPPRSTPPLSTPSNS 135 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 23.4 bits (48), Expect = 1.1 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -2 Query: 419 STSNAGVSSPKSLITTQEQP--TIFLALPSLS 330 STS+ GV+SP+ L T P T L+ PS S Sbjct: 104 STSSTGVASPQDLSTNGAPPRSTPPLSTPSNS 135 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 23.4 bits (48), Expect = 1.1 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -2 Query: 419 STSNAGVSSPKSLITTQEQP--TIFLALPSLS 330 STS+ GV+SP+ L T P T L+ PS S Sbjct: 60 STSSTGVASPQDLSTNGAPPRSTPPLSTPSNS 91 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 23.4 bits (48), Expect = 1.1 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -2 Query: 419 STSNAGVSSPKSLITTQEQP--TIFLALPSLS 330 STS+ GV+SP+ L T P T L+ PS S Sbjct: 104 STSSTGVASPQDLSTNGAPPRSTPPLSTPSNS 135 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 23.4 bits (48), Expect = 1.1 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -2 Query: 419 STSNAGVSSPKSLITTQEQP--TIFLALPSLS 330 STS+ GV+SP+ L T P T L+ PS S Sbjct: 104 STSSTGVASPQDLSTNGAPPRSTPPLSTPSNS 135 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 23.4 bits (48), Expect = 1.1 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -2 Query: 419 STSNAGVSSPKSLITTQEQP--TIFLALPSLS 330 STS+ GV+SP+ L T P T L+ PS S Sbjct: 104 STSSTGVASPQDLSTNGAPPRSTPPLSTPSNS 135 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 21.8 bits (44), Expect = 3.3 Identities = 10/19 (52%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Frame = -2 Query: 143 TNP-PWIRAVLRTSWSAVF 90 +NP W R +L T WSA F Sbjct: 261 SNPIMWDRVMLLTFWSAFF 279 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.8 bits (44), Expect = 3.3 Identities = 8/36 (22%), Positives = 19/36 (52%) Frame = +1 Query: 52 PANPVLSGGAMDVNTALQEVLKTALIHGGLVHGLHE 159 P N ++SG + + T+ + + K G L + +++ Sbjct: 43 PVNDIISGNILPLYTSAENIFKQLREWGRLYYPIYK 78 >AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esterase protein. Length = 510 Score = 21.4 bits (43), Expect = 4.4 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +1 Query: 25 TMADVDVEVPANPVLSGGAMDVNTALQEVL 114 ++ D D+EVP N L +D+ + ++ Sbjct: 148 SLEDPDLEVPGNAGLKDMVLDLKWVQENII 177 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.0 bits (42), Expect = 5.8 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -1 Query: 120 RFKNFLECCVHIHSTTAQHGVSWYLDINIG 31 RF F CV ++T WY+ IG Sbjct: 18 RFGQFCAICVPKITSTNNEVPRWYICYTIG 47 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,469 Number of Sequences: 336 Number of extensions: 2422 Number of successful extensions: 18 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11141978 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -