BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_H21 (546 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 27 7.4 02_03_0086 - 15069265-15069432,15069641-15069698,15070023-15070048 27 7.4 >04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 Length = 1034 Score = 27.5 bits (58), Expect = 7.4 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 271 SAYLPYAFRVDGFRRSIISHQHYI*STTVGIFEKKKNVKYDVSIY-RGGV 417 S Y+P R R +I H + +G+FEK+ VK IY R GV Sbjct: 796 SKYVP-RIRAQPHRCEVIQHLGDMCKELIGVFEKRNRVKPQRIIYFRDGV 844 >02_03_0086 - 15069265-15069432,15069641-15069698,15070023-15070048 Length = 83 Score = 27.5 bits (58), Expect = 7.4 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 39 KDTISYRLILKSISDNSFLLTFGLTVSHDVCLCFVHINS 155 KD ISYR +L I+ SFL + + D+ L H+ S Sbjct: 32 KDRISYRYVLSLINHPSFLRSTDMIHMADLTLVKNHLKS 70 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,928,143 Number of Sequences: 37544 Number of extensions: 244828 Number of successful extensions: 390 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 386 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 390 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1222086348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -