BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_H18 (578 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g24180.1 68417.m03470 pathogenesis-related thaumatin family p... 31 0.73 At2g40770.1 68415.m05030 SNF2 domain-containing protein / helica... 30 0.97 At5g22540.1 68418.m02630 expressed protein contains Pfam profile... 29 1.7 At3g62160.1 68416.m06984 transferase family protein low similari... 29 2.2 At1g09280.2 68414.m01038 expressed protein contains Pfam profile... 29 3.0 At1g09280.1 68414.m01037 expressed protein contains Pfam profile... 29 3.0 At3g52970.1 68416.m05839 cytochrome P450 family protein cytochro... 28 3.9 At5g01770.1 68418.m00096 transducin family protein / WD-40 repea... 27 9.0 At1g17460.1 68414.m02141 myb family transcription factor contain... 27 9.0 >At4g24180.1 68417.m03470 pathogenesis-related thaumatin family protein similar to SP|P28493 Pathogenesis-related protein 5 precursor (PR-5) {Arabidopsis thaliana}; contains Pfam profile PF00314: Thaumatin family Length = 255 Score = 30.7 bits (66), Expect = 0.73 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -1 Query: 119 GIVTSLNRRVPREFRYGTQAVCKT 48 G VT LN++ P E R+G+ + CK+ Sbjct: 165 GCVTDLNQKCPTELRFGSGSACKS 188 >At2g40770.1 68415.m05030 SNF2 domain-containing protein / helicase domain-containing protein / zinc finger (C3HC4 type RING finger) family protein low similarity to SP|P36607 DNA repair protein rad8 {Schizosaccharomyces pombe}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00628: PHD-finger, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 1648 Score = 30.3 bits (65), Expect = 0.97 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +1 Query: 268 ARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLSLAMCSVQ 411 AR++I T+KR + P+ + +++N L+KL A C Q Sbjct: 719 AREVIETLKRDILKRGHTSSDNPLVTHAEAAKLLNSLLKLRQACCHPQ 766 >At5g22540.1 68418.m02630 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 440 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +3 Query: 192 EAIRFLDIFEKTFVQSLQKGKFESYGKKIDFHDEKAINFV 311 EA LD+ KTFV + + + + K F+D + + FV Sbjct: 217 EAKHLLDLIRKTFVPVPSQRRIKDHSSKSSFNDHEYLGFV 256 >At3g62160.1 68416.m06984 transferase family protein low similarity to Taxus cuspidata transferases: 10-deacetylbaccatin III-10-O-acetyl transferase GI:6746554, taxadienol acetyl transferase GI:6978038, 2-debenzoyl-7,13-diacetylbaccatin III-2-O-benzoyl transferase GI:11559716; contains Pfam profile PF02458 transferase family Length = 428 Score = 29.1 bits (62), Expect = 2.2 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -1 Query: 116 IVTSLNRRVPREFRYGTQAVCKTLEVITCC 27 I + L R REFR T +C EVI C Sbjct: 224 IPSDLIERFKREFRASTGEICSAFEVIAAC 253 >At1g09280.2 68414.m01038 expressed protein contains Pfam profile: PF03959 domain of unknown function (DUF341) Length = 575 Score = 28.7 bits (61), Expect = 3.0 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 5/71 (7%) Frame = +1 Query: 337 ICMKKKLQRIINDLMKLS-----LAMCSVQHLNHSTSTPSCPVRLTFTKTALREPAFYQL 501 +C KK + +D K S +A C L + T T LT+ KTA E Sbjct: 402 VCNKKFAWLVSSDFDKPSETGWTVAQCQFDPLQYQTQTEGFDKSLTYLKTAFEEKG---P 458 Query: 502 YDRIVGFTINA 534 +D I+GF+ A Sbjct: 459 FDGILGFSQGA 469 >At1g09280.1 68414.m01037 expressed protein contains Pfam profile: PF03959 domain of unknown function (DUF341) Length = 581 Score = 28.7 bits (61), Expect = 3.0 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 5/71 (7%) Frame = +1 Query: 337 ICMKKKLQRIINDLMKLS-----LAMCSVQHLNHSTSTPSCPVRLTFTKTALREPAFYQL 501 +C KK + +D K S +A C L + T T LT+ KTA E Sbjct: 408 VCNKKFAWLVSSDFDKPSETGWTVAQCQFDPLQYQTQTEGFDKSLTYLKTAFEEKG---P 464 Query: 502 YDRIVGFTINA 534 +D I+GF+ A Sbjct: 465 FDGILGFSQGA 475 >At3g52970.1 68416.m05839 cytochrome P450 family protein cytochrome P450 76A2, eggplant, PIR:S38534 Length = 516 Score = 28.3 bits (60), Expect = 3.9 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = +3 Query: 270 KKIDFHDEKAINFVGNYWQENADLYE----EEVTKDY 368 +K FH EKA G + +E ++ E +E TKDY Sbjct: 242 RKTQFHVEKAFEIAGEFIRERTEVREREKSDEKTKDY 278 >At5g01770.1 68418.m00096 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein mip1 (SP:P87141) [Schizosaccharomyces pombe] Length = 1354 Score = 27.1 bits (57), Expect = 9.0 Identities = 15/55 (27%), Positives = 24/55 (43%) Frame = +3 Query: 57 NGLGSIPEFSWYSPIKTGYYPLMTSYYFPFAQRPDNYNLHSVKNYEAIRFLDIFE 221 +GL +IP +W + +TG + + P D V NYE L+ F+ Sbjct: 1004 SGLSNIPIANWDTKFETGTKTALLHPFSPIVVAADENERIRVWNYEEATLLNGFD 1058 >At1g17460.1 68414.m02141 myb family transcription factor contains Pfam PF00249: Myb-like DNA-binding domain Length = 604 Score = 27.1 bits (57), Expect = 9.0 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +1 Query: 202 GSWTFLKRLSYSPY 243 G WT +K+LS+SPY Sbjct: 517 GKWTEIKKLSFSPY 530 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,760,893 Number of Sequences: 28952 Number of extensions: 265835 Number of successful extensions: 744 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 743 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1131744440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -