BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_H16 (621 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g47820.1 68415.m05968 expressed protein 31 0.81 At1g15460.1 68414.m01858 anion exchange family protein member of... 29 1.9 At3g02620.1 68416.m00253 acyl-[acyl-carrier-protein] desaturase,... 29 3.3 At3g57420.1 68416.m06393 expressed protein contains Pfam domain ... 28 5.7 >At2g47820.1 68415.m05968 expressed protein Length = 805 Score = 30.7 bits (66), Expect = 0.81 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 607 RPNNNTIYPICKWKDSTRSCVIRELQSFGQ 518 RP N + P+C + S C +RE FG+ Sbjct: 561 RPRNPKLLPVCTKRSSLADCTLREAGCFGE 590 >At1g15460.1 68414.m01858 anion exchange family protein member of the PF|00955 Anion exchanger family Length = 683 Score = 29.5 bits (63), Expect = 1.9 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = -1 Query: 609 FDLITTLFIPFVSGRIVLD--HA*SVNSNPLGSMQNFTVIEIFR*NLIY 469 F+ +T LF+P VL+ HA V P SM FT+++IF L Y Sbjct: 516 FERLTLLFVPTSRRFKVLEGAHASFVEKVPYKSMAAFTLLQIFYFGLCY 564 >At3g02620.1 68416.m00253 acyl-[acyl-carrier-protein] desaturase, putative / stearoyl-ACP desaturase, putative similar to Acyl-[acyl-carrier protein] desaturase from Spinacia oleracea SP|P28645, Olea europaea SP|Q43593; contains Pfam profile PF03405 Fatty acid desaturase Length = 396 Score = 28.7 bits (61), Expect = 3.3 Identities = 25/98 (25%), Positives = 40/98 (40%), Gaps = 3/98 (3%) Frame = +1 Query: 133 PNHVSKSITISASWSIENNINHYKNETAVKIWILMKKQNWLLPLSVPF-SPLNPTHQFEA 309 P H+ S T + N + H T K+ I +NW + + P+ + Q + Sbjct: 36 PRHLQVSKTFRPIKEVSNQVTH--TITQEKLEIFKSMENWAQENLLSYLKPVETSWQPQ- 92 Query: 310 VIMFNVLYSAKDYDTFYKTTVYMKDRVNQ--DLYIYVL 417 + L KD D FY+ ++DR + D Y VL Sbjct: 93 ----DFLPETKDEDRFYEQVKELRDRTKEIPDDYFVVL 126 >At3g57420.1 68416.m06393 expressed protein contains Pfam domain PF03385: Protein of unknown function, DUF288 Length = 765 Score = 27.9 bits (59), Expect = 5.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 346 YDTFYKTTVYMKDRVNQDLYIYVLSTLHIHR 438 Y +KT V + R N DLY+ HI++ Sbjct: 534 YGRIFKTVVILSSRKNSDLYVQEAKLDHIYK 564 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,093,089 Number of Sequences: 28952 Number of extensions: 273029 Number of successful extensions: 642 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 631 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 642 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1255974912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -