BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_H15 (499 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 24 0.66 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 2.0 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 23 2.0 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 3.5 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 4.7 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 4.7 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 8.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.1 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 24.2 bits (50), Expect = 0.66 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +1 Query: 196 GY*SDCKRWWTCCTGLCNQ 252 G+ + C R+WTC G + Sbjct: 107 GHETSCTRYWTCWNGTATE 125 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.6 bits (46), Expect = 2.0 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +1 Query: 370 SSLRAQEIRWSRRPCQIPEILPFISFQFASYGIVSICF 483 + L+A +I+W+R +PFI F S + +C+ Sbjct: 268 AELQASQIKWTRIAYMALASVPFI---FDSIHLCDVCY 302 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 22.6 bits (46), Expect = 2.0 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +1 Query: 370 SSLRAQEIRWSRRPCQIPEILPFISFQFASYGIVSICF 483 + L+A +I+W+R +PFI F S + +C+ Sbjct: 286 AELQASQIKWTRIAYMALASVPFI---FDSIHLCDVCY 320 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 3.5 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -3 Query: 200 YPHQRTFPCLAKG*VPVVCTEEV 132 Y T PCLA G P V T ++ Sbjct: 1320 YKEDVTLPCLAVGLPPPVITWKI 1342 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 4.7 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 260 ISKALIAFYQKYVDEASKKEIKDI 331 I K +IAFY K + + EIK I Sbjct: 126 IVKPIIAFYYKPIKTLNGHEIKFI 149 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.4 bits (43), Expect = 4.7 Identities = 7/32 (21%), Positives = 18/32 (56%) Frame = -3 Query: 98 HATLHVLVCSMLPQLQFSYGRKLVRLGLVHVL 3 H LH +C+++ + +G +++ + V V+ Sbjct: 212 HQNLHNKICNLIDEFNECFGLQILGILFVGVI 243 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 20.6 bits (41), Expect = 8.1 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = +1 Query: 244 CNQTSHL*SPYRFLPEICRRSI*EGDQRHSSSIRQKF 354 CN+ HL SP ++ I E ++R + Q++ Sbjct: 244 CNKKQHLESPSALQAKVDPLKIPEAEKRKLIHLLQEY 280 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.1 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +3 Query: 435 VYIISICIVWYRLDLFSLIN 494 +Y++SI ++ L L+S+IN Sbjct: 1034 IYLLSIPSMYLLLILYSIIN 1053 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.1 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +3 Query: 435 VYIISICIVWYRLDLFSLIN 494 +Y++SI ++ L L+S+IN Sbjct: 1034 IYLLSIPSMYLLLILYSIIN 1053 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.1 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +3 Query: 435 VYIISICIVWYRLDLFSLIN 494 +Y++SI ++ L L+S+IN Sbjct: 1034 IYLLSIPSMYLLLILYSIIN 1053 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.1 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +3 Query: 435 VYIISICIVWYRLDLFSLIN 494 +Y++SI ++ L L+S+IN Sbjct: 1034 IYLLSIPSMYLLLILYSIIN 1053 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,873 Number of Sequences: 336 Number of extensions: 3026 Number of successful extensions: 19 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11735024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -