SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0006_H13
         (579 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.     22   3.3  
AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.      22   4.3  
AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.      22   4.3  
AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory recept...    22   4.3  

>AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.
          Length = 697

 Score = 22.2 bits (45), Expect = 3.3
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +1

Query: 421 PSSWTFHCNIQ 453
           P  W FHC+I+
Sbjct: 597 PGYWLFHCHIE 607


>AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.
          Length = 790

 Score = 21.8 bits (44), Expect = 4.3
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = -2

Query: 575 MNWQR*YHGAHR 540
           + W+R +HG HR
Sbjct: 596 LTWRRNFHGPHR 607


>AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.
          Length = 682

 Score = 21.8 bits (44), Expect = 4.3
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = -2

Query: 575 MNWQR*YHGAHR 540
           + W+R +HG HR
Sbjct: 488 LTWRRNFHGPHR 499


>AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory receptor
           candidate 15 protein.
          Length = 455

 Score = 21.8 bits (44), Expect = 4.3
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = +1

Query: 217 SKIRLLQYKNK*IWRNRRNHKWHG*RCGQYRPQSLS 324
           S+I  ++YKN   WRN R       R  Q+  + LS
Sbjct: 323 SEIYNVEYKNVEFWRNIREDYDRLARLTQFLDKELS 358


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 139,720
Number of Sequences: 336
Number of extensions: 3135
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 14412858
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -