BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_H13 (579 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0376 - 20754386-20755392,20755683-20756320,20756433-207566... 29 2.0 12_02_0795 + 23217463-23217684,23218296-23219155,23220001-232209... 29 3.5 06_01_0137 - 1045301-1047601 29 3.5 06_01_0124 - 958935-959967,959985-961222 29 3.5 11_06_0247 - 21669299-21669348,21669673-21670012,21670110-216701... 28 4.7 >05_04_0376 - 20754386-20755392,20755683-20756320,20756433-20756627, 20757730-20757795,20757942-20758007,20758402-20758445 Length = 671 Score = 29.5 bits (63), Expect = 2.0 Identities = 15/57 (26%), Positives = 27/57 (47%) Frame = +2 Query: 143 YQLAIDYQTSTIFFSLSPEVNGKTVLKSAYFNTKTNEYGEIAGITNGMANAVDSIDH 313 Y ++D Q ++ +L +G LK N + EYG A + G A ++ ++H Sbjct: 141 YVSSVDVQWEDVYKALENLNDGSQKLKVGLLNFNSTEYGSWAQLLPGSAVSIVRLEH 197 >12_02_0795 + 23217463-23217684,23218296-23219155,23220001-23220929, 23221184-23221968 Length = 931 Score = 28.7 bits (61), Expect = 3.5 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 1/81 (1%) Frame = +2 Query: 26 IFVWLFVFAEGGDKKKCDVI-VIRNNNYEKQVLKSDVHNPYQLAIDYQTSTIFFSLSPEV 202 + + L EG +K VI ++ K L ++V +L +Q F SLS + Sbjct: 264 VVIKLLTEGEGASSQKLKVISIVGPGGLGKTTLANEVFR--KLESQFQCRA-FVSLSQQP 320 Query: 203 NGKTVLKSAYFNTKTNEYGEI 265 + K ++++ Y EYG I Sbjct: 321 DVKKIVRNIYCQVSQQEYGNI 341 >06_01_0137 - 1045301-1047601 Length = 766 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = +2 Query: 167 TSTIFFSLSPEVNGKTVLKSAYFNTKTNEYGEIAGITNG 283 T+ ++ +++ E+ + LK YF+T YG++ I G Sbjct: 634 TARVYGTMTTELKRELGLKGYYFSTDATRYGKMMAIAGG 672 >06_01_0124 - 958935-959967,959985-961222 Length = 756 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = +2 Query: 167 TSTIFFSLSPEVNGKTVLKSAYFNTKTNEYGEIAGITNG 283 T+ ++ +++ E+ + LK YF+T YG++ I G Sbjct: 624 TARVYGAMTTELKRELGLKGYYFSTDATRYGKMMAIAGG 662 >11_06_0247 - 21669299-21669348,21669673-21670012,21670110-21670199, 21670280-21670339,21670564-21670856,21671176-21671245, 21671623-21671970,21673188-21673318,21673418-21673901, 21674839-21675558 Length = 861 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 340 SLHVRLHYQESYKPRYHRL*HMANVFLPSSW 432 S+H+ LH + PR HRL H++ P W Sbjct: 11 SIHLHLHLHLHHPPRLHRLLHLSTT-SPYPW 40 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,623,267 Number of Sequences: 37544 Number of extensions: 285926 Number of successful extensions: 640 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 634 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 640 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1352600424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -