BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_H08 (490 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25240.1 68415.m03020 serpin, putative / serine protease inhi... 60 8e-10 At2g26390.1 68415.m03167 serpin, putative / serine protease inhi... 59 2e-09 At3g45220.1 68416.m04880 serpin, putative / serine protease inhi... 56 1e-08 At1g47710.1 68414.m05302 serpin, putative / serine protease inhi... 50 8e-07 At2g35580.1 68415.m04357 serpin family protein / serine protease... 46 1e-05 At1g64030.1 68414.m07252 serpin family protein / serine protease... 42 3e-04 At1g64010.1 68414.m07250 serpin, putative / serine protease inhi... 38 0.004 At5g19600.1 68418.m02333 sulfate transporter, putative similar t... 31 0.55 At5g59940.1 68418.m07516 DC1 domain-containing protein / UV-B li... 30 0.73 At4g00510.1 68417.m00070 cyclic nucleotide-binding domain-contai... 29 1.7 At3g11910.1 68416.m01460 ubiquitin-specific protease, putative s... 29 1.7 At1g63450.1 68414.m07175 exostosin family protein contains Pfam ... 29 1.7 At1g22440.1 68414.m02805 alcohol dehydrogenase, putative similar... 28 2.9 At1g22430.1 68414.m02804 alcohol dehydrogenase, putative similar... 28 2.9 At5g50780.1 68418.m06291 ATP-binding region, ATPase-like domain-... 28 3.9 At4g22110.2 68417.m03197 alcohol dehydrogenase, putative similar... 27 6.8 At4g22110.1 68417.m03196 alcohol dehydrogenase, putative similar... 27 6.8 At2g19710.1 68415.m02303 expressed protein contains Pfam profi... 27 6.8 At5g06600.2 68418.m00746 ubiquitin-specific protease 12 (UBP12) ... 27 9.0 At5g06600.1 68418.m00745 ubiquitin-specific protease 12 (UBP12) ... 27 9.0 At5g04860.1 68418.m00509 expressed protein 27 9.0 At5g01040.1 68418.m00007 laccase family protein / diphenol oxida... 27 9.0 At2g04280.1 68415.m00420 expressed protein 27 9.0 >At2g25240.1 68415.m03020 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 324 Score = 60.1 bits (139), Expect = 8e-10 Identities = 47/163 (28%), Positives = 77/163 (47%), Gaps = 9/163 (5%) Frame = +3 Query: 3 FNASETKEKDFHVDSTTIVKKPTMSLLQPLFYTENKELEAQLVELPYKESG--FRMLVLL 176 F+A+ TK+ DFH+ T VK P M+ + + + ++ LPY E F M + L Sbjct: 118 FDANMTKKNDFHLLDGTSVKVPFMTNYEDQYLRSYDGFK--VLRLPYIEDQRQFSMYIYL 175 Query: 177 PDKLDGLSSVLDKAG-EKGLLEDVFRLRPTNRKVKLEMPKFEIKSKLDLKPLMPKFGVSK 353 P+ +GL+ +L+K G E ++ L + +PKF+ + + ++ G++ Sbjct: 176 PNDKEGLAPLLEKIGSEPSFFDNHIPLHCISVGA-FRIPKFKFSFEFNASEVLKDMGLTS 234 Query: 354 IFN------EPAPNIVKGDSVVVSEAFQEAFITVDEEGATAGA 464 FN E + GD + VS +A I VDEEG A A Sbjct: 235 PFNNGGGLTEMVDSPSNGDDLYVSSILHKACIEVDEEGTEAAA 277 >At2g26390.1 68415.m03167 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 389 Score = 58.8 bits (136), Expect = 2e-09 Identities = 49/163 (30%), Positives = 72/163 (44%), Gaps = 9/163 (5%) Frame = +3 Query: 3 FNASETKEKDFHVDSTTIVKKPTMSLLQPLFYTENKELEAQLVELPYKESG--FRMLVLL 176 F+A TK+ DFH+ VK P M + + Q++ LPY E F M + L Sbjct: 183 FDAKLTKDNDFHLLDGNTVKVPFMMSYKDQYLRGYDGF--QVLRLPYVEDKRHFSMYIYL 240 Query: 177 PDKLDGLSSVLDKAG-EKGLLEDVFRLRPTNRKVKLEMPKFEIKSKLDLKPLMPKFGVSK 353 P+ DGL+++L+K E G L+ L T L +PK + ++ G++ Sbjct: 241 PNDKDGLAALLEKISTEPGFLDSHIPLHRTPVDA-LRIPKLNFSFEFKASEVLKDMGLTS 299 Query: 354 IFN------EPAPNIVKGDSVVVSEAFQEAFITVDEEGATAGA 464 F E + GD + VS +A I VDEEG A A Sbjct: 300 PFTSKGNLTEMVDSPSNGDKLHVSSIIHKACIEVDEEGTEAAA 342 >At3g45220.1 68416.m04880 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 393 Score = 56.4 bits (130), Expect = 1e-08 Identities = 48/172 (27%), Positives = 79/172 (45%), Gaps = 13/172 (7%) Frame = +3 Query: 3 FNASETKEKDFHVDSTTIVKKPTMSLLQPLFYTENKELEAQLVELPYKESG--FRMLVLL 176 F+A TK DFH+ T+VK P M+ + Y E + +++ LPY E F M + L Sbjct: 183 FDAKLTKSYDFHLLDGTMVKVPFMTNYKKQ-YLEYYD-GFKVLRLPYVEDQRQFAMYIYL 240 Query: 177 PDKLDGLSSVLDKAGEKGLLEDVFRLRPTNRKVKLEMPKFEIKSKLDLKPLMPKFGVSKI 356 P+ DGL ++L++ K D R ++PKF+ + ++ + G++ Sbjct: 241 PNDRDGLPTLLEEISSKPRFLDNHIPRQRILTEAFKIPKFKFSFEFKASDVLKEMGLTLP 300 Query: 357 FNEPA-----------PNIVKGDSVVVSEAFQEAFITVDEEGATAGAFNWCS 479 F + N+ +++ VS F +A I VDEEG A A + S Sbjct: 301 FTHGSLTEMVESPSIPENLCVAENLFVSNVFHKACIEVDEEGTEAAAVSVAS 352 >At1g47710.1 68414.m05302 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 391 Score = 50.0 bits (114), Expect = 8e-07 Identities = 46/165 (27%), Positives = 78/165 (47%), Gaps = 11/165 (6%) Frame = +3 Query: 3 FNASETKEKDFHVDSTTIVKKPTMSLLQPLFYTENKELEAQLVELPYKESG----FRMLV 170 F+ S T+E +FH+ V P M+ + + + + ++ LPY + F M Sbjct: 181 FDESLTQEGEFHLLDGNKVTAPFMTSKKKQYVSAYDGFK--VLGLPYLQGQDKRQFSMYF 238 Query: 171 LLPDKLDGLSSVLDK-AGEKGLLEDVFRLRPTNRKVKLEMPKFEIKSKLDLKPLMPKFGV 347 LPD +GLS +LDK G L++ R + + ++PKF+ D ++ G+ Sbjct: 239 YLPDANNGLSDLLDKIVSTPGFLDNHIPRRQVKVR-EFKIPKFKFSFGFDASNVLKGLGL 297 Query: 348 SKIFN--EPAPNIVK----GDSVVVSEAFQEAFITVDEEGATAGA 464 + F+ E +V+ G ++ VS F +A I V+EEG A A Sbjct: 298 TSPFSGEEGLTEMVESPEMGKNLCVSNIFHKACIEVNEEGTEAAA 342 >At2g35580.1 68415.m04357 serpin family protein / serine protease inhibitor family protein similar to protein zx [Hordeum vulgare subsp. vulgare] GI:19071, serpin [Triticum aestivum] GI:1885350; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 374 Score = 46.4 bits (105), Expect = 1e-05 Identities = 37/122 (30%), Positives = 62/122 (50%), Gaps = 7/122 (5%) Frame = +3 Query: 3 FNASETKEKDFHVDSTTIVKKPTMSLLQPLFYTENKELEAQLVELPYKES-----GFRML 167 F+ S TK+ DFH+ T V+ P M+ YT E +++ L Y+ F M Sbjct: 182 FDPSLTKDSDFHLLDGTKVRVPFMTGAS-CRYTHVYE-GFKVINLQYRRGREDSRSFSMQ 239 Query: 168 VLLPDKLDGLSSVLDK-AGEKGLLEDVFRLRPTNRKVK-LEMPKFEIKSKLDLKPLMPKF 341 + LPD+ DGL S+L++ A +G L+D L + +K L++P+F+ + + F Sbjct: 240 IYLPDEKDGLPSMLERLASTRGFLKDNEVLPSHSAVIKELKIPRFKFDFAFEASEALKGF 299 Query: 342 GV 347 G+ Sbjct: 300 GL 301 >At1g64030.1 68414.m07252 serpin family protein / serine protease inhibitor family protein similar to phloem serpin-1 [Cucurbita maxima] GI:9937311, serpin [Triticum aestivum] GI:871551; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 385 Score = 41.5 bits (93), Expect = 3e-04 Identities = 35/124 (28%), Positives = 57/124 (45%), Gaps = 9/124 (7%) Frame = +3 Query: 3 FNASETKEKDFHVDSTTIVKKPTMSLLQPLFYTENKELEAQLVELPYKESG------FRM 164 F T++ DF++ + T V P MS + + + ++ LPY+ F M Sbjct: 182 FEKYYTRDNDFYLVNGTSVSVPFMSSYENQYVRAYDGFK--VLRLPYQRGSDDTNRKFSM 239 Query: 165 LVLLPDKLDGLSSVLDK-AGEKGLLEDVFRLRPTNRK--VKLEMPKFEIKSKLDLKPLMP 335 LPDK DGL +L+K A G L+ PT R K +PKF+I+ + ++ Sbjct: 240 YFYLPDKKDGLDDLLEKMASTPGFLDSHI---PTYRDELEKFRIPKFKIEFGFSVTSVLD 296 Query: 336 KFGV 347 + G+ Sbjct: 297 RLGL 300 >At1g64010.1 68414.m07250 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 185 Score = 37.9 bits (84), Expect = 0.004 Identities = 44/154 (28%), Positives = 76/154 (49%), Gaps = 7/154 (4%) Frame = +3 Query: 18 TKEKDFHVDSTTIVKKPTMSLLQPLFYTENKELEAQLVELPYKESG-----FRMLVLLPD 182 TK++DFH+ + T V MS + Y E + ++++LP+++ F M LPD Sbjct: 2 TKDRDFHLINGTSVSVSLMSSYKDQ-YIEAYD-GFKVLKLPFRQGNDTSRNFSMHFYLPD 59 Query: 183 KLDGLSSVLDK-AGEKGLLEDVFRLRPTNRKV-KLEMPKFEIKSKLDLKPLMPKFGVSKI 356 + DGL ++++K A G L+ + KV + +PKF+I+ F S+ Sbjct: 60 EKDGLDNLVEKMASSVGFLDS--HIPSQKVKVGEFGIPKFKIEF---------GFSASRA 108 Query: 357 FNEPAPNIVKGDSVVVSEAFQEAFITVDEEGATA 458 FN + D + + +Q+A + +DEEGA A Sbjct: 109 FNR-----LGLDEMAL---YQKACVEIDEEGAEA 134 >At5g19600.1 68418.m02333 sulfate transporter, putative similar to sulfate transporter [Arabidopsis thaliana] GI:2285885; contains Pfam profiles PF00916: Sulfate transporter family, PF01740: STAS domain; supporting cDNA gi|14141683|dbj|AB061739.1| Length = 634 Score = 30.7 bits (66), Expect = 0.55 Identities = 25/96 (26%), Positives = 45/96 (46%) Frame = +3 Query: 72 MSLLQPLFYTENKELEAQLVELPYKESGFRMLVLLPDKLDGLSSVLDKAGEKGLLEDVFR 251 + L P+F+ + + +++ E +LL L G+S++ D G + LLE Sbjct: 521 LQLGSPVFFANSTYVRERILRWIRDEPEAIEFLLLD--LSGVSTI-DMTGMETLLEIQRI 577 Query: 252 LRPTNRKVKLEMPKFEIKSKLDLKPLMPKFGVSKIF 359 L N K+ + P+FE+ K+ L + K G +F Sbjct: 578 LGSKNIKMVIINPRFEVLEKMMLSHFVEKIGKEYMF 613 >At5g59940.1 68418.m07516 DC1 domain-containing protein / UV-B light-insensitive protein, putative similar to ULI3 (UV-B light insensitive) [Arabidopsis thaliana] GI:17225050; contains Pfam profile PF03107: DC1 domain Length = 651 Score = 30.3 bits (65), Expect = 0.73 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +3 Query: 342 GVSKIFNEPAPNIVKGDSVVVSEAFQEAFITVDEEGATAGAFNWCSCCT 488 G S+I + AP V GD+++ + ++ + + +EG A+ C CT Sbjct: 346 GTSEITEDIAPFKVMGDNLISHFSHEQHTLRLHKEGIIHDAYALCEACT 394 >At4g00510.1 68417.m00070 cyclic nucleotide-binding domain-containing protein contains Pfam profile: PF00027 cyclic nucleotide-binding domain Length = 175 Score = 29.1 bits (62), Expect = 1.7 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +3 Query: 195 LSSVLDKAGEKGLLEDVFRLRPTNRKVKLEMPKFEIKSKLDLKPLMPKF 341 + SV D E+ L+ED+ L P + +V P F S L +K L F Sbjct: 118 IKSVSDSDKERCLVEDILYLEPLDVRVSPNCPSFSSISVLMIKVLTIHF 166 >At3g11910.1 68416.m01460 ubiquitin-specific protease, putative strong similarity to ubiquitin-specific protease 12 (UBP12) [Arabidopsis thaliana] GI:11993471; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF00917: MATH domain Length = 1115 Score = 29.1 bits (62), Expect = 1.7 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 1/69 (1%) Frame = +3 Query: 90 LFYTENKEL-EAQLVELPYKESGFRMLVLLPDKLDGLSSVLDKAGEKGLLEDVFRLRPTN 266 L Y +N+EL + +E P KE F M + KL V+++ EK L+D +LR T+ Sbjct: 794 LEYVQNRELVRFRTLEKP-KEDEFTMEL---SKLHTYDDVVERVAEKLGLDDPSKLRLTS 849 Query: 267 RKVKLEMPK 293 + PK Sbjct: 850 HNCYSQQPK 858 >At1g63450.1 68414.m07175 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 641 Score = 29.1 bits (62), Expect = 1.7 Identities = 32/105 (30%), Positives = 49/105 (46%), Gaps = 4/105 (3%) Frame = +3 Query: 138 PYKESGFRMLVL--LPDKLDGLSSVLDKAGEKGLLEDVFRLRPTNRKVKLEMPKFEIKSK 311 P ++S F L+L +P D S+ L ED R K +++ + + K Sbjct: 529 PTRKSIFDSLILGCIPVIFDPYSAYYQYTWH--LPEDHRRYSVYINKEDVKLKRVNVIEK 586 Query: 312 LDLKPLMPKFGV-SKIFNEPAPNIVKGDSVVVSEAFQEAF-ITVD 440 L K L + + S I +E P +V GDS E F++AF IT+D Sbjct: 587 LMSKTLREREDMRSYIVHELLPGLVYGDSNAKFERFRDAFDITMD 631 >At1g22440.1 68414.m02805 alcohol dehydrogenase, putative similar to alcohol dehydrogenase ADH GI:7705214 from [Lycopersicon esculentum]; contains Pfam zinc-binding dehydrogenase domain PF00107 Length = 386 Score = 28.3 bits (60), Expect = 2.9 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = -1 Query: 463 APAVAPSSSTVINASWKASDTTTLSPLTMFGAGSLNIFETPNLGIKG 323 A ++ S +T + A+WK +D S + +FG G++ + + ++G Sbjct: 178 AALLSCSVATGLGAAWKVADVEEGSTVVIFGLGAVGLAVAEGVRLRG 224 >At1g22430.1 68414.m02804 alcohol dehydrogenase, putative similar to alcohol dehydrogenase ADH GI:7705214 from [Lycopersicon esculentum]; contains Pfam zinc-binding dehydrogenase domain PF00107 Length = 388 Score = 28.3 bits (60), Expect = 2.9 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = -1 Query: 466 KAPAVAPSSSTVINASWKASDTTTLSPLTMFGAGSLNIFETPNLGIKG 323 KA ++ ST I A+WK ++ S + +FG G++ + ++G Sbjct: 179 KAALLSCGVSTGIGAAWKVANVEEGSTIAIFGLGAVGLAVAEGARLRG 226 >At5g50780.1 68418.m06291 ATP-binding region, ATPase-like domain-containing protein low similarity to microrchidia [Homo sapiens] GI:5410257; contains Pfam profile PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein Length = 823 Score = 27.9 bits (59), Expect = 3.9 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 2/69 (2%) Frame = +3 Query: 111 ELEAQLVELPYKESGFRMLVLLPDKLDGLSSVLDKAGEKGLL--EDVFRLRPTNRKVKLE 284 EL + ELP +SG R L L + + L LDK E LL +D+ R R + ++ E Sbjct: 702 ELPGKSSELPKPQSGPRTLSQLEQENNELRERLDKKEEVFLLLQKDLRRERELRKTLEAE 761 Query: 285 MPKFEIKSK 311 + + K K Sbjct: 762 VETLKNKLK 770 >At4g22110.2 68417.m03197 alcohol dehydrogenase, putative similar to alcohol dehydrogenase ADH GI:7705214 from [Lycopersicon esculentum]; contains Pfam zinc-binding dehydrogenase domain PF00107 Length = 389 Score = 27.1 bits (57), Expect = 6.8 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -1 Query: 466 KAPAVAPSSSTVINASWKASDTTTLSPLTMFGAGSLNI 353 KA ++ ST I A+WK ++ S + +FG G++ + Sbjct: 180 KAALLSCGVSTGIGAAWKVANVEKGSTVAVFGLGAVGL 217 >At4g22110.1 68417.m03196 alcohol dehydrogenase, putative similar to alcohol dehydrogenase ADH GI:7705214 from [Lycopersicon esculentum]; contains Pfam zinc-binding dehydrogenase domain PF00107 Length = 389 Score = 27.1 bits (57), Expect = 6.8 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -1 Query: 466 KAPAVAPSSSTVINASWKASDTTTLSPLTMFGAGSLNI 353 KA ++ ST I A+WK ++ S + +FG G++ + Sbjct: 180 KAALLSCGVSTGIGAAWKVANVEKGSTVAVFGLGAVGL 217 >At2g19710.1 68415.m02303 expressed protein contains Pfam profile: PF03398 eukaryotic protein of unknown function, DUF292 Length = 937 Score = 27.1 bits (57), Expect = 6.8 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = -1 Query: 301 ISNFGISNFTFLLVGLSLNTSSRRPFSPA-LSNTDDKPSSLSGSRTNIRKPDSLYGNS 131 I +FG S+ L + NT +R F P S++D+ S + K DSLY +S Sbjct: 722 IDDFGQSSRKDLYSKKASNTETRPSFMPPHPSSSDEDDSDMQHPGRTETKSDSLYSHS 779 >At5g06600.2 68418.m00746 ubiquitin-specific protease 12 (UBP12) almost identical to ubiquitin-specific protease 12 GI:11993471 [Arabidopsis thaliana], one amino acid difference Length = 1115 Score = 26.6 bits (56), Expect = 9.0 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = +3 Query: 90 LFYTENKEL-EAQLVELPYKESGFRMLVLLPDKLDGLSSVLDKAGEKGLLEDVFRLRPTN 266 L Y +N++L + +E P KE F VL K V++K EK L+D +LR T+ Sbjct: 794 LEYVQNRQLVRFRALEKP-KEDEF---VLELSKQHTYDDVVEKVAEKLGLDDPSKLRLTS 849 Query: 267 RKVKLEMPK 293 + PK Sbjct: 850 HNCYSQQPK 858 >At5g06600.1 68418.m00745 ubiquitin-specific protease 12 (UBP12) almost identical to ubiquitin-specific protease 12 GI:11993471 [Arabidopsis thaliana], one amino acid difference Length = 1116 Score = 26.6 bits (56), Expect = 9.0 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = +3 Query: 90 LFYTENKEL-EAQLVELPYKESGFRMLVLLPDKLDGLSSVLDKAGEKGLLEDVFRLRPTN 266 L Y +N++L + +E P KE F VL K V++K EK L+D +LR T+ Sbjct: 795 LEYVQNRQLVRFRALEKP-KEDEF---VLELSKQHTYDDVVEKVAEKLGLDDPSKLRLTS 850 Query: 267 RKVKLEMPK 293 + PK Sbjct: 851 HNCYSQQPK 859 >At5g04860.1 68418.m00509 expressed protein Length = 782 Score = 26.6 bits (56), Expect = 9.0 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 445 SSSTVINASWKASDTTTLSPLTMFG 371 SSS N+ W SD + PL+ FG Sbjct: 398 SSSDESNSDWYRSDDAIMKPLSQFG 422 >At5g01040.1 68418.m00007 laccase family protein / diphenol oxidase family protein similar to laccase [Pinus taeda][GI:13661201], lac110 laccase, Populus trichocarpa, EMBL:PTY13773 Length = 584 Score = 26.6 bits (56), Expect = 9.0 Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = +3 Query: 258 PTNRKVKLEMPKFEIKSKLDLKPLMP--KFGVSKI-FNEPAPNIVKGDSVVVSEA 413 P +K + KFE ++ D+K + P K V KI FN +++ +++ E+ Sbjct: 412 PNQPPLKFDYTKFEQRTNNDMKMMFPERKTSVKKIRFNSTVEIVLQNTAIISPES 466 >At2g04280.1 68415.m00420 expressed protein Length = 568 Score = 26.6 bits (56), Expect = 9.0 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 3/82 (3%) Frame = -1 Query: 379 MFGAGSLNI--FETPNLGIKGLRSNLLFISNFGISNFTFLLVGLSLNTSSRRPFSPALSN 206 MFG ++ F NLG ++ L I N G S F F ++ ++ ++ P P Sbjct: 1 MFGRSAIRGGGFRAENLG----QNALTLIGNIGFSLFVFGVLIFTIIAATYEPEDPLFHP 56 Query: 205 TDDKPSSL-SGSRTNIRKPDSL 143 +D + L S S +R DS+ Sbjct: 57 SDKITTFLTSTSNATLRSDDSV 78 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,084,487 Number of Sequences: 28952 Number of extensions: 236534 Number of successful extensions: 880 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 841 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 874 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 848837888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -