BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_G23 (586 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 23 2.5 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 21 7.7 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 7.7 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 22.6 bits (46), Expect = 2.5 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +2 Query: 80 KVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEEFLKL 217 K +S+ + ++ D EYY + YD E D NKK + + L Sbjct: 385 KGVSIMVPISGLHYDPEYYPDPEKYDPERFSDE--NKKNLTPYTYL 428 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 21.0 bits (42), Expect = 7.7 Identities = 6/19 (31%), Positives = 14/19 (73%) Frame = +1 Query: 457 PYEVYPQFFANIWTLYFRF 513 PY VY Q+++ ++Y+++ Sbjct: 262 PYPVYNQWWSGPLSMYYQY 280 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = +3 Query: 363 RVHLNEGQFSCTHIILQLSSA 425 RVH E + C H ++ S + Sbjct: 211 RVHTGERPYGCEHCSMKFSDS 231 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,385 Number of Sequences: 336 Number of extensions: 2898 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14621740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -