BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_G23 (586 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC100827-1|AAI00828.1| 727|Homo sapiens synaptic vesicle glycop... 30 5.2 BC100826-1|AAI00827.1| 727|Homo sapiens synaptic vesicle glycop... 30 5.2 BC100825-1|AAI00826.1| 727|Homo sapiens synaptic vesicle glycop... 30 5.2 BC100824-1|AAI00825.1| 727|Homo sapiens synaptic vesicle glycop... 30 5.2 AF231919-1|AAF72943.1| 2248|Homo sapiens C21orf108 protein. 30 6.9 AB011111-1|BAA25465.2| 2046|Homo sapiens KIAA0539 protein protein. 30 6.9 >BC100827-1|AAI00828.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 30.3 bits (65), Expect = 5.2 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +2 Query: 14 VSPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANID 175 V +T + VD E ++ S FQD + DD+YY G+ Y+ EAN D Sbjct: 22 VKKQTVKKVNQAVDRAQDEYTQRSYSRFQDEED---DDDYYPAGETYNGEANDD 72 >BC100826-1|AAI00827.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 30.3 bits (65), Expect = 5.2 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +2 Query: 14 VSPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANID 175 V +T + VD E ++ S FQD + DD+YY G+ Y+ EAN D Sbjct: 22 VKKQTVKKVNQAVDRAQDEYTQRSYSRFQDEED---DDDYYPAGETYNGEANDD 72 >BC100825-1|AAI00826.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 30.3 bits (65), Expect = 5.2 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +2 Query: 14 VSPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANID 175 V +T + VD E ++ S FQD + DD+YY G+ Y+ EAN D Sbjct: 22 VKKQTVKKVNQAVDRAQDEYTQRSYSRFQDEED---DDDYYPAGETYNGEANDD 72 >BC100824-1|AAI00825.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 30.3 bits (65), Expect = 5.2 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +2 Query: 14 VSPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANID 175 V +T + VD E ++ S FQD + DD+YY G+ Y+ EAN D Sbjct: 22 VKKQTVKKVNQAVDRAQDEYTQRSYSRFQDEED---DDDYYPAGETYNGEANDD 72 >AF231919-1|AAF72943.1| 2248|Homo sapiens C21orf108 protein. Length = 2248 Score = 29.9 bits (64), Expect = 6.9 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +2 Query: 191 KAVEEFLKLYRIGYLPKYYEFSIFYQKLREEAIALFHLFYYAKDFETSTE 340 KA + LK YL K F + ++ L + + F+ F+Y+ DFE TE Sbjct: 1713 KAALQILKPEEHMYL-KVSNFLLSHEYLNMDKVPGFYQFFYSSDFEQKTE 1761 >AB011111-1|BAA25465.2| 2046|Homo sapiens KIAA0539 protein protein. Length = 2046 Score = 29.9 bits (64), Expect = 6.9 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +2 Query: 191 KAVEEFLKLYRIGYLPKYYEFSIFYQKLREEAIALFHLFYYAKDFETSTE 340 KA + LK YL K F + ++ L + + F+ F+Y+ DFE TE Sbjct: 1511 KAALQILKPEEHMYL-KVSNFLLSHEYLNMDKVPGFYQFFYSSDFEQKTE 1559 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,906,607 Number of Sequences: 237096 Number of extensions: 1634677 Number of successful extensions: 3530 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3530 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6098631048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -