BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_G21 (643 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g01240.1 68415.m00036 reticulon family protein (RTNLB15) cont... 30 1.1 At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly... 29 2.6 At5g40200.1 68418.m04878 DegP protease, putative contains simila... 29 3.5 At2g43880.1 68415.m05455 polygalacturonase, putative / pectinase... 28 4.6 At4g22320.1 68417.m03227 expressed protein 28 6.1 At4g01440.1 68417.m00185 nodulin MtN21 family protein similar to... 28 6.1 At2g42370.1 68415.m05243 expressed protein 28 6.1 At1g72700.1 68414.m08407 haloacid dehalogenase-like hydrolase fa... 28 6.1 At5g41610.2 68418.m05055 cation/hydrogen exchanger, putative (CH... 27 8.0 At5g41610.1 68418.m05056 cation/hydrogen exchanger, putative (CH... 27 8.0 >At2g01240.1 68415.m00036 reticulon family protein (RTNLB15) contains PFam profile PF02453: Reticulon Length = 160 Score = 30.3 bits (65), Expect = 1.1 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 2/72 (2%) Frame = +3 Query: 315 LREEAIALFHLFYYAKDFETFYKSAAFARVHLNEGQF--LVRILYAVIQRNDTHGLLMDS 488 + E + + + Y KD +TF K+ + + N G + L+ ILY + + T ++ Sbjct: 64 MMEGHLLMLYEIAYGKDNKTFLKTILYVAIIYNIGSYISLLTILYICLVCSMTIPVVYMQ 123 Query: 489 FYQLLMKFIHKI 524 F +L+ F+ K+ Sbjct: 124 FQELIDSFMGKV 135 >At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly identical to GI:9957293; contains Pfam profile: PF01397 terpene synthase family Length = 591 Score = 29.1 bits (62), Expect = 2.6 Identities = 25/108 (23%), Positives = 46/108 (42%), Gaps = 2/108 (1%) Frame = +3 Query: 111 ERQKKVLSLFQD--VDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEEFLKLYRIGYLPK 284 E+ +K+L+ Q +DQ+ D+ K+G Y EA IDN ++ + Sbjct: 82 EKVRKMLNDEQKTYLDQLEFIDDLQKLGVSYHFEAEIDNILTSSYKKDRTNIQESDLHAT 141 Query: 285 YYEFSIFYQKLREEAIALFHLFYYAKDFETFYKSAAFARVHLNEGQFL 428 EF +F Q + +F +F ++ F + + + L E +L Sbjct: 142 ALEFRLFRQHGFNVSEDVFDVF--MENCGKFDRDDIYGLISLYEASYL 187 >At5g40200.1 68418.m04878 DegP protease, putative contains similarity to DegP2 protease GI:13172275 from [Arabidopsis thaliana] Length = 592 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +3 Query: 159 NVDDEYYKIGKDYDVEANIDNYTNKKAVEEFLKLYRI 269 N +DEY K DYD +D T K+A + L + I Sbjct: 542 NCEDEYMKFNLDYDQIVVLDTKTAKEATLDILTTHCI 578 >At2g43880.1 68415.m05455 polygalacturonase, putative / pectinase, putative similar to polygalacturonase 4 [Lycopersicon esculentum] GI:2459815; contains Pfam profile PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 394 Score = 28.3 bits (60), Expect = 4.6 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +3 Query: 537 WTLYLRFYRTKMQDGILHDAKAINYWNCKRGRAVC 641 W L+ + R + G + DA+ YW+C++ + C Sbjct: 111 WILFAKVNRISVYGGTI-DARGAGYWSCRKKGSHC 144 >At4g22320.1 68417.m03227 expressed protein Length = 238 Score = 27.9 bits (59), Expect = 6.1 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +3 Query: 87 KDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEE 248 K V +E QKK ++ ++ D++ DD KI +D VE D K VEE Sbjct: 115 KYVPIAVLEEQKKEITEIEEDDKIEEDD---KIDEDNKVEQE-DKVDEDKTVEE 164 >At4g01440.1 68417.m00185 nodulin MtN21 family protein similar to MtN21 GI:2598575 (root nodule development) from [Medicago truncatula] Length = 365 Score = 27.9 bits (59), Expect = 6.1 Identities = 19/51 (37%), Positives = 25/51 (49%) Frame = +3 Query: 36 ALVQSSVVSPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIG 188 ++V S VV Y F V + E +KK+ F + DQ DDE YK G Sbjct: 306 SVVGSGVVIFGLYIFLLGKVRLMKEECEKKLPCRFNEDDQEEDDDEQYKKG 356 >At2g42370.1 68415.m05243 expressed protein Length = 715 Score = 27.9 bits (59), Expect = 6.1 Identities = 9/28 (32%), Positives = 20/28 (71%) Frame = -3 Query: 530 RKNFVDKLHKELVKRIHEQSMSIIALDN 447 R++ + +LHKE + +H++++ I L+N Sbjct: 556 REDIIQQLHKESYEELHKKNVEIYKLEN 583 >At1g72700.1 68414.m08407 haloacid dehalogenase-like hydrolase family protein similar to Potential phospholipid-transporting ATPase (EC 3.6.3.1) from Homo sapiens [SP|Q9Y2Q0, SP|O43520]; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 1228 Score = 27.9 bits (59), Expect = 6.1 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = -3 Query: 398 SESGTLVEG-FKVFSIVEQVEKSNSLFP*LLVEDGELIVLGKITDSVQFQ 252 S SG ++E +KV +++E K + + E+G++++L K DS+ F+ Sbjct: 595 SGSGQIIEREYKVLNLLEFTSKRKRMTVIVRDEEGQILLLCKGADSIIFE 644 >At5g41610.2 68418.m05055 cation/hydrogen exchanger, putative (CHX18) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 742 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 293 LIVLGKITDSVQFQEFFNSFLIGVVI 216 ++V G ITD++ F +F++GV+I Sbjct: 204 VLVCGFITDAIGIHSMFGAFVVGVLI 229 >At5g41610.1 68418.m05056 cation/hydrogen exchanger, putative (CHX18) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 810 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 293 LIVLGKITDSVQFQEFFNSFLIGVVI 216 ++V G ITD++ F +F++GV+I Sbjct: 272 VLVCGFITDAIGIHSMFGAFVVGVLI 297 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,546,370 Number of Sequences: 28952 Number of extensions: 272125 Number of successful extensions: 680 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -