BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_G15 (586 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 24 4.2 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 9.6 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 23 9.6 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 23.8 bits (49), Expect = 4.2 Identities = 12/42 (28%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +1 Query: 31 WCYKN-LQARRETRESTWRNPGWDECVAYTVPLIREMHCRIL 153 W Y ++ R E +W PGW + Y + RIL Sbjct: 112 WIYSLCMRCRVEYTTPSWEPPGWQKVCPYPLCPSYRQFARIL 153 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 9.6 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +3 Query: 84 QPRLGRMRRLH-STTDQRNALPHSR 155 QP +G RR STTD+ L H R Sbjct: 410 QPSVGGSRRRGGSTTDREKRLSHDR 434 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 22.6 bits (46), Expect = 9.6 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +3 Query: 84 QPRLGRMRRLH-STTDQRNALPHSR 155 QP +G RR STTD+ L H R Sbjct: 411 QPSVGGSRRRGGSTTDREKRLSHDR 435 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 581,285 Number of Sequences: 2352 Number of extensions: 11120 Number of successful extensions: 27 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55927431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -