BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_G13 (556 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB051434-1|BAB33317.1| 159|Homo sapiens KIAA1647 protein protein. 30 4.7 BC032666-1|AAH32666.1| 660|Homo sapiens OGFR protein protein. 30 6.3 AK131080-1|BAC85130.1| 563|Homo sapiens FLJ00279 protein protein. 29 8.3 >AB051434-1|BAB33317.1| 159|Homo sapiens KIAA1647 protein protein. Length = 159 Score = 30.3 bits (65), Expect = 4.7 Identities = 20/46 (43%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +1 Query: 1 PARGT---RGSRPC-TRSRTCRW-HWTSRS*TGWRTWRCTRPFHWR 123 PARG R RP R+++C W H +R T T RCTR WR Sbjct: 23 PARGNTDMRTRRPTHRRTQSCTWRHVRTRRPTRRPTHRCTRTCTWR 68 >BC032666-1|AAH32666.1| 660|Homo sapiens OGFR protein protein. Length = 660 Score = 29.9 bits (64), Expect = 6.3 Identities = 20/38 (52%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +1 Query: 1 PARGTRGSRPCTRSRTCRW-HWTSRS-*TGWRTWRCTR 108 PARGTR TRSR R +RS TG R WR TR Sbjct: 16 PARGTRTQGTRTRSRRSRGRRGPARSRMTGSRNWRATR 53 >AK131080-1|BAC85130.1| 563|Homo sapiens FLJ00279 protein protein. Length = 563 Score = 29.5 bits (63), Expect = 8.3 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = +1 Query: 16 RGSRPCTRS-RTCRWHWT--SRS*TGWRTWRCTRPFHWRCGRRR 138 R R C+RS TC W WT +R+ WR R + WR RRR Sbjct: 16 RPRRGCSRSWTTCWWTWTTSARARATWRRSRRSLTSSWR--RRR 57 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 52,439,063 Number of Sequences: 237096 Number of extensions: 913711 Number of successful extensions: 2981 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2809 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2981 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5533942988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -