BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_G12 (507 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0315 + 16306053-16306753,16306779-16308479,16308894-16309257 28 3.7 08_01_0914 + 9010613-9013316,9013537-9013748 28 3.7 06_03_0791 - 24641350-24641418,24641684-24641965,24642318-246425... 28 3.7 08_02_0021 + 11307795-11308093,11308454-11308556,11309623-113099... 28 5.0 12_02_1069 + 25801309-25801433,25802429-25802620,25803130-258031... 27 6.5 01_06_0693 - 31280108-31281271 27 8.7 >11_04_0315 + 16306053-16306753,16306779-16308479,16308894-16309257 Length = 921 Score = 28.3 bits (60), Expect = 3.7 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 92 YAKDFETFYKSAAFARVHLNEGQFLYAYYIAV 187 Y KD FY + + + EG+FL ++Y+ + Sbjct: 697 YVKDSRLFYSFSESTKELVQEGEFLQSFYVQI 728 >08_01_0914 + 9010613-9013316,9013537-9013748 Length = 971 Score = 28.3 bits (60), Expect = 3.7 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = -3 Query: 367 IHILLFLFYNSIINSLCIVKNTVLHFSAINLK*SVHINEELWIN 236 +H+L+F ++I+S+C + T F +K +V NE L++N Sbjct: 656 LHVLIFCIVGTLISSMCCM--TAYCFIKRKMKLNVVDNENLFLN 697 >06_03_0791 - 24641350-24641418,24641684-24641965,24642318-24642537, 24642657-24642776,24643056-24643132,24643220-24643339, 24644121-24644186,24644265-24644479,24645450-24645582, 24646562-24646708,24647301-24647596,24648222-24648319, 24648425-24648471,24649340-24649449,24649663-24649735, 24650795-24650899 Length = 725 Score = 28.3 bits (60), Expect = 3.7 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 1/20 (5%) Frame = +2 Query: 383 NTFLYH-NEEQRLTYLTEDI 439 +T LYH NEE RL+YL +D+ Sbjct: 466 STVLYHLNEEMRLSYLAQDL 485 >08_02_0021 + 11307795-11308093,11308454-11308556,11309623-11309931, 11310190-11310618 Length = 379 Score = 27.9 bits (59), Expect = 5.0 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +2 Query: 284 RTKMQDGILHDAKAINYGIVKEEEQYVYYANYSNTFLYHNEE--QRLTYLTEDIGFN 448 R Q G + D I YGI +++Y+ S+ + NE+ T +ED+G N Sbjct: 284 RIHRQKGHVEDHLYI-YGIASTYTRWIYHGEQSDAGINENEDHLDEHTSFSEDVGIN 339 >12_02_1069 + 25801309-25801433,25802429-25802620,25803130-25803159, 25803426-25803500,25803599-25804373,25804549-25804614, 25804746-25804811,25804898-25805140,25805407-25805502 Length = 555 Score = 27.5 bits (58), Expect = 6.5 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +3 Query: 117 TRVPLSL-VCT*MRDSSCTHIILQLSSAMILMDSFYQLLMK 236 T+ P S V T + S+CTH QLSSA +L + +K Sbjct: 65 TQCPCSFAVATSISSSTCTHFTPQLSSAHLLSSQLKEKELK 105 >01_06_0693 - 31280108-31281271 Length = 387 Score = 27.1 bits (57), Expect = 8.7 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 5/63 (7%) Frame = +2 Query: 251 FVNMDTLLKIYRTKMQDGILHDAKAINYGIVKEEEQYVYYANYSNTF-----LYHNEEQR 415 ++ MDT+ ++R +++G+ D +A+N +VK Q ++ + F +Y E Sbjct: 196 YMYMDTVSALFRQMLEEGVPPDTRALNV-LVKGYAQSLHLNDALRVFHQMRPVYGCEPDA 254 Query: 416 LTY 424 LTY Sbjct: 255 LTY 257 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,735,098 Number of Sequences: 37544 Number of extensions: 244479 Number of successful extensions: 485 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 485 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1083123860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -