BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_G12 (507 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132865-13|CAB60609.1| 496|Caenorhabditis elegans Hypothetical... 29 2.6 AL110490-16|CAB54451.2| 922|Caenorhabditis elegans Hypothetical... 29 2.6 Z54236-7|CAA90982.1| 1471|Caenorhabditis elegans Hypothetical pr... 28 3.4 AF047657-7|AAK18943.1| 424|Caenorhabditis elegans Hypothetical ... 28 4.5 >AL132865-13|CAB60609.1| 496|Caenorhabditis elegans Hypothetical protein Y62E10A.16 protein. Length = 496 Score = 28.7 bits (61), Expect = 2.6 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 63 RLLLFSTCSTMLKTLKPSTRVPLSLV 140 R+ F TCS +KT+K +PLS+V Sbjct: 290 RIEQFLTCSETIKTVKSDALIPLSIV 315 >AL110490-16|CAB54451.2| 922|Caenorhabditis elegans Hypothetical protein Y48B6A.11 protein. Length = 922 Score = 28.7 bits (61), Expect = 2.6 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +2 Query: 329 NYGIVKEEEQYVYYANYSNTFLYHNEEQRLTYLTEDIGFNSYYYYF 466 NY I Y+Y+ Y TF +H E+ L Y + F + Y+F Sbjct: 242 NYEIKGVNTVYLYFGMYKTTFPWHAEDMDL-YSINFLHFGAPKYWF 286 >Z54236-7|CAA90982.1| 1471|Caenorhabditis elegans Hypothetical protein C27B7.7 protein. Length = 1471 Score = 28.3 bits (60), Expect = 3.4 Identities = 13/56 (23%), Positives = 29/56 (51%) Frame = +3 Query: 102 TLKPSTRVPLSLVCT*MRDSSCTHIILQLSSAMILMDSFYQLLMKFIHNSSLIWTL 269 T P T PLS+ CT ++ S ++ +++ + +DS + ++ +H + T+ Sbjct: 256 TADPQTNEPLSITCT-VKSVSKASVLWKVNGIKVSVDSSFYTVVTSVHEDFIESTI 310 >AF047657-7|AAK18943.1| 424|Caenorhabditis elegans Hypothetical protein F37B4.7 protein. Length = 424 Score = 27.9 bits (59), Expect = 4.5 Identities = 22/50 (44%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 38 IFYQKLREEAIALFHLFYYAKDFETFYKSA-AFARVHLNEGQFLYAYYIA 184 +FY IA F + Y K +T YKSA AF R L G+FL AY +A Sbjct: 101 VFYGWATATEIAYF-AYIYVKVPKTEYKSATAFTRAALLVGRFL-AYALA 148 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,213,647 Number of Sequences: 27780 Number of extensions: 229203 Number of successful extensions: 588 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 588 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 977860456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -