BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_G12 (507 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g39460.1 68418.m04779 F-box family protein contains Pfam:PF00... 31 0.34 At5g39480.1 68418.m04781 F-box family protein contains Pfam:PF00... 31 0.45 At2g38340.1 68415.m04710 AP2 domain-containing transcription fac... 29 1.4 At5g63410.1 68418.m07960 leucine-rich repeat transmembrane prote... 28 4.2 At5g13700.1 68418.m01595 polyamine oxidase, putative similar to ... 28 4.2 At3g57300.1 68416.m06378 transcriptional activator, putative sim... 27 7.3 At1g68180.1 68414.m07788 zinc finger (C3HC4-type RING finger) fa... 27 9.6 >At5g39460.1 68418.m04779 F-box family protein contains Pfam:PF00646 F-box domain ; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 571 Score = 31.5 bits (68), Expect = 0.34 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +3 Query: 312 TMQRLLIMEL*KRKSSMCITPTIPTLSFTIMK 407 T+QR+ + E+ K+ C++P +PT +FT K Sbjct: 522 TLQRINLGEILKKSLGSCVSPLLPTKNFTYTK 553 >At5g39480.1 68418.m04781 F-box family protein contains Pfam:PF00646 F-box domain ; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 568 Score = 31.1 bits (67), Expect = 0.45 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +3 Query: 273 LRFIALKCKTVFFTMQRLLIMEL*KRKSSMCITPTIPTLSFTIMK 407 L F+ + K V T+QRL + E+ K+ C+ P P+ +FT M+ Sbjct: 507 LAFVWKETKVVI-TLQRLNLTEILKKGLGSCVPPLPPSKNFTYMR 550 >At2g38340.1 68415.m04710 AP2 domain-containing transcription factor, putative (DRE2B) Similar to DREB2A (GP:3738230) and DREB2B (GP:3738232) [Arabidopsis thaliana]; DRE binding proteins may be involved in dehydration or low temp response Length = 244 Score = 29.5 bits (63), Expect = 1.4 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +2 Query: 341 VKEEEQYVYYANYSNTFLYHNEEQRLTYLTEDIGFNSYYYYF 466 VK EE Y Y + L +NE Q +Y + GF+SY+ YF Sbjct: 202 VKSEEGYSYDRFKLDNGLLYNEPQSSSY-HQGGGFDSYFEYF 242 >At5g63410.1 68418.m07960 leucine-rich repeat transmembrane protein kinase, putative contains similarity to receptor-like protein kinase Length = 680 Score = 27.9 bits (59), Expect = 4.2 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +2 Query: 368 YANYSNTFLYHNEEQRLTYLTEDIGFNSYYYYFHSHLPFWWSSERY 505 Y + SN FL+ + +L+ + + F + +F+ LP W+ S Y Sbjct: 145 YLDLSNNFLFGSVPPKLSTMVKLETFRFDHNFFNGTLPSWFDSYWY 190 >At5g13700.1 68418.m01595 polyamine oxidase, putative similar to SP|O64411 Polyamine oxidase precursor (EC 1.5.3.11) from Zea mays Length = 472 Score = 27.9 bits (59), Expect = 4.2 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +2 Query: 230 YEVYPQFFVNMDTLLKIYRTKMQDGILHDAKAINYGIVKEEEQYVYYANY 379 Y++ +F V + YR K+ + ++ N +VK E+ VY ANY Sbjct: 188 YKMAEEFLVTSHGNILDYRLKLNQVVREVQQSRNGVVVKTEDGSVYEANY 237 >At3g57300.1 68416.m06378 transcriptional activator, putative similar to transcriptional activator SRCAP [Homo sapiens] GI:5106572; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 1507 Score = 27.1 bits (57), Expect = 7.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +2 Query: 134 ARVHLNEGQFLYAYYIAVIQRNDTHGFV 217 AR L+EG L +Y+ ++++ DT+ V Sbjct: 295 ARTILSEGGVLQVHYVKILEKGDTYEIV 322 >At1g68180.1 68414.m07788 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 248 Score = 26.6 bits (56), Expect = 9.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -2 Query: 425 GRSTSVLHYGKGKCWNSWRNTHTALPLLQF 336 G+ LH C SW N H P+ +F Sbjct: 151 GKELKCLHLYHSSCIVSWLNIHNTCPICRF 180 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,519,395 Number of Sequences: 28952 Number of extensions: 208619 Number of successful extensions: 557 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 541 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 557 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 908059136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -