BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_G11 (578 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 28 0.19 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 25 1.8 DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. 23 9.5 AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding pr... 23 9.5 AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding pr... 23 9.5 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 28.3 bits (60), Expect = 0.19 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Frame = +1 Query: 376 VYEVATFYTM---FIRRPIGKYHVQVCTTTPCWL 468 VYE+ T+ F++ +YH Q T+TPCW+ Sbjct: 412 VYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWI 445 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 25.0 bits (52), Expect = 1.8 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +1 Query: 385 VATFYTMFIRRPIGKYHVQVCTTTPCWL 468 + T F++ +Y Q T+TPCW+ Sbjct: 450 MCTIRMSFVKGWGAEYRRQTVTSTPCWI 477 >DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. Length = 353 Score = 22.6 bits (46), Expect = 9.5 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = +3 Query: 387 CNILYYVY*ATNRKVSCTSVYNDSMLASWIGCCFESYQGSN 509 CN ++V + ++ ++ + ++ S + CF Y GSN Sbjct: 253 CNSKWFVETSIILFLNKKDLFEEKIVRSPLTICFPEYTGSN 293 >AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding protein AgamOBP42 protein. Length = 288 Score = 22.6 bits (46), Expect = 9.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 331 AMHKVAEILNLPRMRVYE 384 A H+ LNLP+ R+Y+ Sbjct: 36 AQHECVTYLNLPKHRLYQ 53 >AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding protein OBPjj83d protein. Length = 288 Score = 22.6 bits (46), Expect = 9.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 331 AMHKVAEILNLPRMRVYE 384 A H+ LNLP+ R+Y+ Sbjct: 36 AQHECVTYLNLPKHRLYQ 53 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 608,963 Number of Sequences: 2352 Number of extensions: 11174 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55086417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -