BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_G09 (651 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 25 0.48 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 25 0.84 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 23 3.4 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 23 3.4 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 7.8 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 25.4 bits (53), Expect = 0.48 Identities = 23/105 (21%), Positives = 48/105 (45%) Frame = +1 Query: 214 KRKLTIPSSLGYGNRGAGNVIPPHATLHFEVELINIGDSPPTTNVFKEIDADQNNMLSRE 393 +RK+ S Y R + +++ + ++ S P + KE +NN + Sbjct: 13 QRKIIRSRSRRYSKRFSSSIVDRRSPSSSRSPSPSLLTSQPHQDHNKE--KSKNNHHCNQ 70 Query: 394 EVSEYLKKQMVPSDGQEMSEDVKQMLESHDKLVEEIFQHEDKDKN 528 + +E L + + SD + D K+ D+L ++F+ E+K+K+ Sbjct: 71 D-TEKLNQLEIESDNSKEVNDKKEENFIVDRLRNDLFECENKEKS 114 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 475 SHDKLVEEIFQHEDKDKNGFISHEE 549 S + LV +F H D++ NG + EE Sbjct: 233 SKEYLVSIMFSHYDRNNNGNLEREE 257 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 382 LSREEVSEYLKKQMVPSDGQEMSEDVKQMLESHD 483 L ++E L Q + SDG + + DVK L D Sbjct: 758 LDKQETGVTLVVQEISSDGLKFAFDVKTTLNISD 791 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = +1 Query: 232 PSSLGYGNRGAGNVIPPHATLHFEVELINIGDSPPTTNVFKEID 363 P + Y R N+ P L F +EL + +SP F + D Sbjct: 111 PIATKYLRRYEDNIFLPEDCLLFTIELDRVLESPRGKYEFSKYD 154 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = +1 Query: 232 PSSLGYGNRGAGNVIPPHATLHFEVELINIGDSPPTTNVFKEID 363 P + Y R N+ P L F +EL + +SP F + D Sbjct: 126 PIATKYLRRYEDNIFLPEDCLLFTIELDRVLESPRGKYEFSKYD 169 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.4 bits (43), Expect = 7.8 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = +1 Query: 310 LINIGDSPPTTNVFKEIDADQNNMLSREEVSEYLKKQMVPSDGQEM 447 L+ +G P NV K+ ADQ+ + +++V + L+K P QE+ Sbjct: 10 LVALGVCAP--NV-KQRAADQDLLNKQQDVIQLLQKISQPIPNQEL 52 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,712 Number of Sequences: 438 Number of extensions: 3263 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -