BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_G08 (399 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 26 0.44 Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like pr... 22 9.5 Z32645-1|CAA83567.1| 258|Anopheles gambiae chymotrypsinogen-lik... 22 9.5 Z18888-1|CAA79326.1| 258|Anopheles gambiae chymotrypsin 2 protein. 22 9.5 Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. 22 9.5 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 26.2 bits (55), Expect = 0.44 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 157 IFKSITLISNPSLVRDNPGHRTPSGPQK 74 ++ I +I P L +D H TPS PQ+ Sbjct: 1773 LYSQINIIKLPILRKDRLIHSTPSSPQE 1800 >Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like protease ANCHYM1 protein. Length = 259 Score = 21.8 bits (44), Expect = 9.5 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 10 SSLRLTGSPRTKTWGCSTGPVTSVDLMESGARDCRE 117 +++RLTG RT G S + S++++ DC + Sbjct: 149 ATVRLTGWGRTSANGPSPTLLQSLNVVTLSNEDCNK 184 >Z32645-1|CAA83567.1| 258|Anopheles gambiae chymotrypsinogen-like protease ANCHYM2 protein. Length = 258 Score = 21.8 bits (44), Expect = 9.5 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 10 SSLRLTGSPRTKTWGCSTGPVTSVDLMESGARDCR 114 +++RLTG RT T G + S++++ DC+ Sbjct: 149 ATVRLTGWGRTSTNGNVPTLLQSLNVVTLSNEDCK 183 >Z18888-1|CAA79326.1| 258|Anopheles gambiae chymotrypsin 2 protein. Length = 258 Score = 21.8 bits (44), Expect = 9.5 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 10 SSLRLTGSPRTKTWGCSTGPVTSVDLMESGARDCR 114 +++RLTG RT T G + S++++ DC+ Sbjct: 149 ATVRLTGWGRTSTNGNVRTLLQSLNVVTLSNEDCK 183 >Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. Length = 259 Score = 21.8 bits (44), Expect = 9.5 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 10 SSLRLTGSPRTKTWGCSTGPVTSVDLMESGARDCRE 117 +++RLTG RT G S + S++++ DC + Sbjct: 149 ATVRLTGWGRTSANGPSPTLLQSLNVVTLSNEDCNK 184 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 418,876 Number of Sequences: 2352 Number of extensions: 9787 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31639662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -