BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_G07 (581 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0938 + 32901143-32901215,32901841-32901982,32902243-329023... 34 0.095 02_03_0372 + 18273141-18274767,18275136-18276023,18276117-18276523 28 4.7 05_03_0389 - 13409848-13409964,13410049-13410114,13410209-134103... 28 6.2 04_03_0822 - 20054832-20055179,20056794-20056847,20057561-200576... 28 6.2 02_04_0516 + 23593088-23593116,23593209-23593336,23593527-235937... 28 6.2 >02_05_0938 + 32901143-32901215,32901841-32901982,32902243-32902314, 32902573-32902644,32902711-32902782,32902913-32902948, 32903001-32903072,32903319-32903387,32903483-32903554, 32903668-32903739,32903838-32903909,32904153-32904224, 32904470-32904541,32904623-32904694,32904782-32904853, 32904911-32905003,32905150-32905218,32905315-32905386, 32905479-32905552,32905643-32905771,32905966-32906331, 32906584-32906954,32907522-32907890 Length = 884 Score = 33.9 bits (74), Expect = 0.095 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Frame = +2 Query: 182 CLINRNSEATPYTPLLLNHSSTLPQFETVNEFIVVEPGTTFKLSCHNRENTPNS--FQRF 355 CL+ + + P P L SST+P + VNE++ + G+T LSC N + ++ F +F Sbjct: 820 CLVYPDPPSKPALPPALPQSSTVPSY--VNEYVSLRGGST--LSCENSSSASDAELFLKF 875 Query: 356 PE 361 E Sbjct: 876 GE 877 >02_03_0372 + 18273141-18274767,18275136-18276023,18276117-18276523 Length = 973 Score = 28.3 bits (60), Expect = 4.7 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 324 GKTPPTLSRDSPKMNTNWRSLATTRTRSGSMGNCTSIQ 437 G+ PP L R S N + + T G+MGN TS+Q Sbjct: 110 GEIPPELGRLSRLQYLNLNRNSLSGTIPGAMGNLTSLQ 147 >05_03_0389 - 13409848-13409964,13410049-13410114,13410209-13410325, 13410822-13410893,13410979-13411258,13411528-13411730, 13412230-13412316,13412705-13412758,13413042-13413221, 13414402-13414576,13414628-13414918,13414923-13415344 Length = 687 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 300 VVPGSTTINSFTVSNCGKVEEWFRSNGV 217 V P + + FT S GKV++WF +N V Sbjct: 72 VSPDTIRLRLFTFSLLGKVKQWFYTNRV 99 >04_03_0822 - 20054832-20055179,20056794-20056847,20057561-20057657, 20057752-20057780 Length = 175 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 330 TPPTLSRDSPKMNTNWRSLATTRTRSGSMGNCTSIQISTAT 452 T PT + SPKM +W S A+ + G G+ + AT Sbjct: 92 TTPTGAAASPKMRRSWSSAASASSGGGGHGSGPKCVCAPAT 132 >02_04_0516 + 23593088-23593116,23593209-23593336,23593527-23593714, 23593861-23593919,23594997-23595345,23596081-23596333, 23596404-23597476 Length = 692 Score = 27.9 bits (59), Expect = 6.2 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +2 Query: 260 ETVNEFIVVEPGTTFKLSCHNRENTPNSFQRFPEDE-YELEVTCNHEDTFWVDGKLYKYS 436 E ++ +V+ P ++ K R + P S PE Y L++ +HE+ V K ++ Sbjct: 379 EALSSSMVLTPTSSNKHKAIARVSAPTSGGALPELVLYLLDLGMDHEEIKNVVRKFPAFA 438 Query: 437 DFHCNRKVLPVV 472 ++ +RK+ P+V Sbjct: 439 YYNVDRKIKPLV 450 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,290,158 Number of Sequences: 37544 Number of extensions: 356023 Number of successful extensions: 928 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 909 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 928 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1364465340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -