BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_G03 (525 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 22 3.8 AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory recept... 22 3.8 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 6.7 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 21.8 bits (44), Expect = 3.8 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +3 Query: 102 VKVLTSKMSLPKTMRAVGLYKHLPITDTDSLL 197 + V ++++ + R L +P+T TDS+L Sbjct: 295 ITVTVCELTILEYKRTKKLLYRIPVTKTDSML 326 >AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory receptor candidate 25 protein. Length = 314 Score = 21.8 bits (44), Expect = 3.8 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +3 Query: 102 VKVLTSKMSLPKTMRAVGLYKHLPITDTDSLL 197 + V ++++ + R L +P+T TDS+L Sbjct: 120 ITVTVCELTILEYKRTKKLLYRIPVTKTDSML 151 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.0 bits (42), Expect = 6.7 Identities = 14/48 (29%), Positives = 20/48 (41%) Frame = +3 Query: 27 IVYCVK*TMNIAFSLIIVFILATTQVKVLTSKMSLPKTMRAVGLYKHL 170 + YC K +SLI + L V + S LP A ++K L Sbjct: 19 LFYCYKTIKQHIYSLISLSYLPGPPVNDIISGNILPLYTSAENIFKQL 66 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,152 Number of Sequences: 336 Number of extensions: 2395 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12678017 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -