BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_G02 (637 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0268 - 6994095-6994555,6996873-6996982,6997237-6998612 31 0.58 11_04_0469 - 18064430-18064494,18064621-18064747,18064823-180651... 27 9.4 >03_02_0268 - 6994095-6994555,6996873-6996982,6997237-6998612 Length = 648 Score = 31.5 bits (68), Expect = 0.58 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -2 Query: 513 DNFGQFQKASRFLQ*LIYGKNQNVRAWRWWIYLYYLV 403 ++FGQ K SR IY + VR W W +Y LV Sbjct: 482 EDFGQLNKHSRLGGAAIYSGSPAVRRWHWLVYTPTLV 518 >11_04_0469 - 18064430-18064494,18064621-18064747,18064823-18065120, 18065230-18065380,18067718-18067944,18068033-18068367, 18068452-18068485,18069445-18069500 Length = 430 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/20 (50%), Positives = 13/20 (65%), Gaps = 2/20 (10%) Frame = -3 Query: 575 LFCKCNHPNCLTE--VWKRP 522 + C+C+HPN L VWK P Sbjct: 78 ILCQCDHPNVLKPIGVWKNP 97 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,188,859 Number of Sequences: 37544 Number of extensions: 266834 Number of successful extensions: 456 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 456 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -