BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_G01 (511 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39999-14|ABF71722.1| 1483|Caenorhabditis elegans Hypothetical p... 28 3.4 AM773423-1|CAO78927.1| 1473|Caenorhabditis elegans AGRin (synapt... 28 3.4 Z81479-1|CAB03944.1| 1043|Caenorhabditis elegans Hypothetical pr... 27 7.9 >U39999-14|ABF71722.1| 1483|Caenorhabditis elegans Hypothetical protein F41G3.12 protein. Length = 1483 Score = 28.3 bits (60), Expect = 3.4 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 427 TPEYXPVCGSDX*TYKNQGRL 489 T E+ VCGSD TY N+ RL Sbjct: 469 TDEFKEVCGSDGKTYSNECRL 489 >AM773423-1|CAO78927.1| 1473|Caenorhabditis elegans AGRin (synaptic protein) homologfamily member protein. Length = 1473 Score = 28.3 bits (60), Expect = 3.4 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 427 TPEYXPVCGSDX*TYKNQGRL 489 T E+ VCGSD TY N+ RL Sbjct: 477 TDEFKEVCGSDGKTYSNECRL 497 >Z81479-1|CAB03944.1| 1043|Caenorhabditis elegans Hypothetical protein C34F6.1 protein. Length = 1043 Score = 27.1 bits (57), Expect = 7.9 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +1 Query: 391 QTIEKCAENCISTPEYXPVCGSDX*TYKNQGRLFCAPN 504 Q ++ C + T E P S+ YKN R+ C PN Sbjct: 284 QCVDACETETV-TDEANPCKFSNAAKYKNGSRIICGPN 320 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,434,535 Number of Sequences: 27780 Number of extensions: 266019 Number of successful extensions: 655 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 629 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 655 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 988489374 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -