BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_F24 (111 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory pro... 24 0.17 DQ855489-1|ABH88176.1| 122|Tribolium castaneum chemosensory pro... 19 4.7 DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory pro... 19 4.7 AJ973444-1|CAJ01491.1| 122|Tribolium castaneum hypothetical pro... 19 4.7 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 19 6.2 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 19 6.2 >DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory protein 5 protein. Length = 144 Score = 23.8 bits (49), Expect = 0.17 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +3 Query: 3 MKTVLVLA-GLIALVQSSVVSPKTYHFKTKD 92 MKT ++L G+ ++ S V+ KT H T+D Sbjct: 1 MKTFVILFFGVFFIIFSDFVNGKTLHRSTRD 31 >DQ855489-1|ABH88176.1| 122|Tribolium castaneum chemosensory protein 2 protein. Length = 122 Score = 19.0 bits (37), Expect = 4.7 Identities = 8/31 (25%), Positives = 16/31 (51%) Frame = +3 Query: 12 VLVLAGLIALVQSSVVSPKTYHFKTKDVDAV 104 +++LA LIA ++ + D+DA+ Sbjct: 3 IIILAVLIATAVAATYDVYPTKYDNVDIDAI 33 >DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory protein 1 protein. Length = 112 Score = 19.0 bits (37), Expect = 4.7 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +1 Query: 25 RGSLPSCNP 51 RGS P C P Sbjct: 74 RGSCPQCTP 82 >AJ973444-1|CAJ01491.1| 122|Tribolium castaneum hypothetical protein protein. Length = 122 Score = 19.0 bits (37), Expect = 4.7 Identities = 8/31 (25%), Positives = 16/31 (51%) Frame = +3 Query: 12 VLVLAGLIALVQSSVVSPKTYHFKTKDVDAV 104 +++LA LIA ++ + D+DA+ Sbjct: 3 IIILAVLIATAVAATYDVYPTKYDNVDIDAI 33 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 18.6 bits (36), Expect = 6.2 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -3 Query: 70 VFGDTTLDCTRA 35 +FG T CTR+ Sbjct: 23 IFGFVTFTCTRS 34 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 18.6 bits (36), Expect = 6.2 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -3 Query: 70 VFGDTTLDCTRA 35 +FG T CTR+ Sbjct: 41 IFGFVTFTCTRS 52 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,443 Number of Sequences: 336 Number of extensions: 243 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 17 effective length of database: 116,873 effective search space used: 2220587 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 34 (18.5 bits)
- SilkBase 1999-2023 -