BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_F23 (596 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0803 + 11365959-11366390,11366470-11366502,11367158-113672... 28 4.9 02_05_0797 - 31805956-31806902,31806992-31807505 28 4.9 >03_02_0803 + 11365959-11366390,11366470-11366502,11367158-11367214, 11367784-11367945,11367987-11368139,11368218-11368295, 11368377-11368469,11368981-11369071,11369091-11369209 Length = 405 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +3 Query: 426 CFTIDDGQVAALR*ADRATISSTLTVPVVLSFFS 527 CF++D G L ++ A S+TL+ P VLSF S Sbjct: 33 CFSLDAGHRCLLLGSNGAGNSTTLSGPSVLSFLS 66 >02_05_0797 - 31805956-31806902,31806992-31807505 Length = 486 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 446 PGGRPPLSRSRHDKLYLNCTCSLVLFLFHVPSAF*SLVA 562 P G PP S S +D + + FL H P+AF +L+A Sbjct: 70 PDGLPPPSESDNDDVTQDIPTVCTSFLTHGPAAFGALLA 108 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,259,448 Number of Sequences: 37544 Number of extensions: 277628 Number of successful extensions: 744 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 732 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 743 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -