BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_F18 (570 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory recept... 22 3.2 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 21 7.4 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 21 7.4 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 21 7.4 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 21 7.4 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 7.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.8 >AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory receptor candidate 44 protein. Length = 313 Score = 22.2 bits (45), Expect = 3.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -1 Query: 168 LTRLTITPGLDISILDCIS 112 +TR + P LD++ L CI+ Sbjct: 1 MTRAMVRPELDLNSLKCIT 19 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 21.0 bits (42), Expect = 7.4 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 281 NHEKKYHLHAYNTPEHGHFASGVTV 355 NH+ HL Y+T + G + T+ Sbjct: 79 NHDFTQHLSQYDTCQQGIYPENKTL 103 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 21.0 bits (42), Expect = 7.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 265 RPAC*QPRKEIPPPR 309 RP P++EIP P+ Sbjct: 67 RPVALPPKREIPSPK 81 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 21.0 bits (42), Expect = 7.4 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 281 NHEKKYHLHAYNTPEHGHFASGVTV 355 NH+ HL Y+T + G + T+ Sbjct: 79 NHDFTQHLSQYDTCQQGIYPENKTL 103 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 21.0 bits (42), Expect = 7.4 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 281 NHEKKYHLHAYNTPEHGHFASGVTV 355 NH+ HL Y+T + G + T+ Sbjct: 79 NHDFTQHLSQYDTCQQGIYPENKTL 103 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.0 bits (42), Expect = 7.4 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = +2 Query: 119 QSKIDMSSPGVIVNLVNIGFDLRKLGVSPELGLQMRDEVSTSKPP 253 +S++ MS PG ++NL ++ + P L + + PP Sbjct: 132 ESRVMMSPPGNVLNLTMPKYEPNPSIIDPGPALPPTGFLCNNYPP 176 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 9.8 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +3 Query: 351 PFVYHLDYWL 380 PF YH D W+ Sbjct: 930 PFAYHGDQWV 939 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,814 Number of Sequences: 336 Number of extensions: 2718 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14099535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -