BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_F17 (174 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q06342 Cluster: Basic juvenile hormone-suppressible pro... 50 8e-06 UniRef50_P31930 Cluster: Ubiquinol-cytochrome-c reductase comple... 30 8.8 >UniRef50_Q06342 Cluster: Basic juvenile hormone-suppressible protein 1 precursor; n=17; Ditrysia|Rep: Basic juvenile hormone-suppressible protein 1 precursor - Trichoplusia ni (Cabbage looper) Length = 748 Score = 50.4 bits (115), Expect = 8e-06 Identities = 23/47 (48%), Positives = 29/47 (61%) Frame = +3 Query: 21 IESWWYKSRLGFPHRXXXXXXXXXXXXXQMFVIVTPVKTGMVLPSIE 161 +ESWWYK R PHR QMFVIVTPVKT ++LP+++ Sbjct: 604 VESWWYK-RHRLPHRMLLPLGRRGGMPMQMFVIVTPVKTNLLLPNLD 649 >UniRef50_P31930 Cluster: Ubiquinol-cytochrome-c reductase complex core protein 1, mitochondrial precursor; n=22; Coelomata|Rep: Ubiquinol-cytochrome-c reductase complex core protein 1, mitochondrial precursor - Homo sapiens (Human) Length = 480 Score = 30.3 bits (65), Expect = 8.8 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 47 PWLSAQASVTSRNPRRFASPDVRHRD 124 PW A+ +V + P RF ++RHRD Sbjct: 254 PWTYAEDAVPTLTPCRFTGSEIRHRD 279 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,340,892 Number of Sequences: 1657284 Number of extensions: 2503470 Number of successful extensions: 7710 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7709 length of database: 575,637,011 effective HSP length: 37 effective length of database: 514,317,503 effective search space used: 10286350060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -