BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_F13 (618 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 25 1.5 DQ080861-1|AAY89507.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080860-1|AAY89506.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080859-1|AAY89505.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080858-1|AAY89504.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080857-1|AAY89503.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080856-1|AAY89502.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080855-1|AAY89501.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080854-1|AAY89500.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080853-1|AAY89499.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080852-1|AAY89498.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080851-1|AAY89497.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080850-1|AAY89496.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080849-1|AAY89495.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080848-1|AAY89494.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080847-1|AAY89493.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080846-1|AAY89492.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080845-1|AAY89491.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080844-1|AAY89490.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080843-1|AAY89489.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080842-1|AAY89488.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080841-1|AAY89487.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080840-1|AAY89486.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080839-1|AAY89485.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080838-1|AAY89484.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080837-1|AAY89483.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080836-1|AAY89482.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080835-1|AAY89481.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080834-1|AAY89480.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080833-1|AAY89479.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 DQ080832-1|AAY89478.1| 54|Anopheles gambiae GPRgr13 protein. 25 2.6 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 25 2.6 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 25 2.6 DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 23 6.0 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 6.0 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 23 7.9 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 23 7.9 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -1 Query: 228 LTPKIHLPPQLHASSFLKLGASVLPLHQIPTAHH 127 L P +HL LH S + +G + LH HH Sbjct: 324 LEPSLHLS-HLHQMSAMSMGMGSMGLHHHHPGHH 356 >DQ080861-1|AAY89507.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080860-1|AAY89506.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080859-1|AAY89505.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080858-1|AAY89504.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080857-1|AAY89503.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080856-1|AAY89502.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080855-1|AAY89501.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080854-1|AAY89500.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080853-1|AAY89499.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080852-1|AAY89498.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080851-1|AAY89497.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080850-1|AAY89496.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080849-1|AAY89495.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080848-1|AAY89494.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080847-1|AAY89493.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080846-1|AAY89492.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080845-1|AAY89491.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080844-1|AAY89490.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080843-1|AAY89489.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080842-1|AAY89488.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080841-1|AAY89487.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080840-1|AAY89486.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080839-1|AAY89485.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080838-1|AAY89484.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080837-1|AAY89483.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080836-1|AAY89482.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080835-1|AAY89481.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080834-1|AAY89480.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080833-1|AAY89479.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >DQ080832-1|AAY89478.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/32 (25%), Positives = 22/32 (68%) Frame = -2 Query: 599 IKASLHKIIVTKNQNQYFKLDH*TFIIKIHNN 504 IK+++H++ + Q++YF TF++ ++++ Sbjct: 4 IKSTVHRLSLIPGQDRYFHATINTFLLSLNHS 35 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 2.6 Identities = 13/41 (31%), Positives = 15/41 (36%) Frame = -3 Query: 229 TDSKDPPPASTTCFKFSKTWRVCAPTPPDTNCASRSMPSTP 107 +D PPP +TT T PP T S P P Sbjct: 208 SDLPPPPPTTTTTVWIDPTATTTTHVPPTTTTWSDLPPPPP 248 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 24.6 bits (51), Expect = 2.6 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -1 Query: 174 LGASVLPLHQIPTAHHDPCRVLPIYRESCQIKWLDCRVQPVYR 46 +G +VL L ++ T+ HD +E KW D P+Y+ Sbjct: 782 IGMAVLLLWKVLTSIHDRREFARFEKERMMAKW-DTGENPIYK 823 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 410 SWTLSLCTHLVY*YFVKYFENCHT 481 SW+LSL L Y F+ CHT Sbjct: 210 SWSLSLVIILSQYYLQPDFQFCHT 233 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 6.0 Identities = 12/30 (40%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = -1 Query: 213 HLPPQLHASSFLKLGAS-VLPLHQIPTAHH 127 H+PP H S L G S V + PT H Sbjct: 683 HIPPPAHGSLNLSAGGSPVAVVSSSPTGGH 712 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 23.0 bits (47), Expect = 7.9 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 422 SLCTHLVY*YF 454 SLCTHL+Y +F Sbjct: 58 SLCTHLMYGFF 68 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 23.0 bits (47), Expect = 7.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -3 Query: 172 WRVCAPTPPDTN 137 WRVC TP D N Sbjct: 195 WRVCDETPSDHN 206 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 659,085 Number of Sequences: 2352 Number of extensions: 14811 Number of successful extensions: 64 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -