BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_F13 (618 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 4.2 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 5.5 AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding pr... 22 5.5 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 21 9.6 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 21 9.6 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 21 9.6 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 21 9.6 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 22.2 bits (45), Expect = 4.2 Identities = 7/26 (26%), Positives = 16/26 (61%) Frame = +3 Query: 78 ILSDKTLYISGVLGMDRDAQLVSGGV 155 ++SD ++I GV+ +++ V G+ Sbjct: 406 VISDDNIHIKGVISLNKLTSYVISGI 431 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.8 bits (44), Expect = 5.5 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = -2 Query: 80 NGL--TVGSNRFIDIWGCYNGL 21 NGL T NRF+ G YNGL Sbjct: 406 NGLHTTTAHNRFLGGIGGYNGL 427 >AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding protein protein. Length = 132 Score = 21.8 bits (44), Expect = 5.5 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 150 GVGAQTRQVLENLKHVVEAGGGSLESVIKTTILLANMD 263 GVG TR+V ++ VVE + +KTT N + Sbjct: 25 GVGIMTRKVGSSVSPVVELTENNGLYTLKTTSPFKNTE 62 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 515 IHNNEYF*NLNMYDSFQNTLQNINIL 438 IHNN Y N N + + NIN + Sbjct: 90 IHNNNYKYNYNNNNYNKKLYYNINYI 115 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 515 IHNNEYF*NLNMYDSFQNTLQNINIL 438 IHNN Y N N + + NIN + Sbjct: 90 IHNNNYKYNYNNNNYNKKLYYNINYI 115 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 515 IHNNEYF*NLNMYDSFQNTLQNINIL 438 IHNN Y N N + + NIN + Sbjct: 90 IHNNNYKYNYNNNNYNKKLYYNINYI 115 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 515 IHNNEYF*NLNMYDSFQNTLQNINIL 438 IHNN Y N N + + NIN + Sbjct: 90 IHNNNYKYNYNNNNYNKKLYYNINYI 115 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,061 Number of Sequences: 438 Number of extensions: 3967 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18337950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -