BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_F04 (467 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_08_0033 + 27820563-27823482,27823593-27823996 30 1.1 11_04_0315 + 16306053-16306753,16306779-16308479,16308894-16309257 28 3.3 06_03_0499 + 21461608-21463427,21463517-21463627,21463867-214641... 28 4.3 12_02_1069 + 25801309-25801433,25802429-25802620,25803130-258031... 27 7.5 11_01_0398 - 3008074-3008428,3009775-3009926,3010070-3011368 27 7.5 04_04_1392 + 33201015-33201600,33202030-33202406,33202528-332026... 27 7.5 08_01_0321 + 2872609-2873027,2873477-2873905,2874743-2874944,287... 27 10.0 07_03_0475 + 18544637-18544772,18544925-18545031,18545114-185452... 27 10.0 07_03_0154 + 14509979-14512033 27 10.0 01_06_0006 - 25517892-25517935,25518156-25518276,25518598-255187... 27 10.0 >11_08_0033 + 27820563-27823482,27823593-27823996 Length = 1107 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 49 GVTENVSLQDKRCRRSVCGAPEKGFIPFP 135 GV N++L+ R +CG+P G +P P Sbjct: 709 GVFSNITLKSLRGNAGLCGSPRLGLLPCP 737 >11_04_0315 + 16306053-16306753,16306779-16308479,16308894-16309257 Length = 921 Score = 28.3 bits (60), Expect = 3.3 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 347 YAKDFETFYKSAAFARVHLNEGQFLYAYYIAV 442 Y KD FY + + + EG+FL ++Y+ + Sbjct: 697 YVKDSRLFYSFSESTKELVQEGEFLQSFYVQI 728 >06_03_0499 + 21461608-21463427,21463517-21463627,21463867-21464143, 21464265-21464353,21464508-21464595,21464698-21464907, 21464985-21465110,21465429-21465620,21466532-21467188 Length = 1189 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -2 Query: 394 TSESGTLVEGFKVFSIVEQVEKSNSLFP*LLVEDGELIVLGKITDSVQF 248 +S +G + FK+ +++E K + L EDG++++ K DS+ F Sbjct: 599 SSSNGPVEREFKILNLLEFNSKRKRMSVILKDEDGQILLFCKGADSIIF 647 >12_02_1069 + 25801309-25801433,25802429-25802620,25803130-25803159, 25803426-25803500,25803599-25804373,25804549-25804614, 25804746-25804811,25804898-25805140,25805407-25805502 Length = 555 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +3 Query: 372 TRVPLSL-VCT*MRDSSCTHIILQLSSAMIL 461 T+ P S V T + S+CTH QLSSA +L Sbjct: 65 TQCPCSFAVATSISSSTCTHFTPQLSSAHLL 95 >11_01_0398 - 3008074-3008428,3009775-3009926,3010070-3011368 Length = 601 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +1 Query: 7 PSSSGAHCPRAIQCGVTENVSLQDKRCRRSVCGAPEKGFIPFPRCRPS 150 PS + A + Q GV +VSL+ ++ + +K + PF C PS Sbjct: 296 PSPTKAQSRGSPQLGVPLHVSLKTCSHPQNASSSGQKKYTPFEECYPS 343 >04_04_1392 + 33201015-33201600,33202030-33202406,33202528-33202638, 33202720-33202815,33202899-33203570 Length = 613 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -2 Query: 322 SLFP*LLVEDGELIVLGKITDSVQFQEFFNSFLIGVVID 206 S FP + E GE+ V GK+ D + SF + V ++ Sbjct: 500 SKFPSAISESGEITVEGKVKDGIPHLTKVGSFQVDVSLE 538 >08_01_0321 + 2872609-2873027,2873477-2873905,2874743-2874944, 2875909-2875947,2876309-2876354,2877380-2877922, 2878827-2880847,2880972-2881215,2881642-2881684, 2881923-2881962,2883580-2883675,2883712-2883759, 2883964-2884290 Length = 1498 Score = 26.6 bits (56), Expect = 10.0 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -1 Query: 347 SRTSGKEQ*PLPLAFGRRWRTHSTWED 267 SRT G P P RRWR H +D Sbjct: 404 SRTRGARNSPPPPTSARRWRPHPPADD 430 >07_03_0475 + 18544637-18544772,18544925-18545031,18545114-18545295, 18545467-18545599,18545708-18545920 Length = 256 Score = 26.6 bits (56), Expect = 10.0 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 215 YTNKKAVEEFLKLYRIGYLPKYYEFSIFYQKLREEAIAL 331 Y NK V K+ P Y EF I+YQ+ ++ IA+ Sbjct: 147 YPNKNIV---FKITESSNFPNYLEFEIWYQQGNQDIIAV 182 >07_03_0154 + 14509979-14512033 Length = 684 Score = 26.6 bits (56), Expect = 10.0 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = +1 Query: 7 PSSSGAHCPRAIQCGVTENVSLQDKRCRRSVCGAPEKGFIPFPRCRP 147 PSSS P A + N KR +S +PE+G +P P P Sbjct: 7 PSSSAPSSPAASSDSIDLNFLPFLKREPKSEPASPERGPLPLPAAAP 53 >01_06_0006 - 25517892-25517935,25518156-25518276,25518598-25518733, 25519189-25519280,25519358-25519426,25519710-25519821, 25519897-25520015,25520302-25520355,25520811-25520891, 25520968-25521051,25521124-25521315,25521633-25521746, 25521832-25521978,25522066-25522302,25522762-25522810, 25522894-25523027,25523124-25523324,25523532-25523701, 25523773-25523875,25524198-25524361,25525015-25525055, 25525144-25525187 Length = 835 Score = 26.6 bits (56), Expect = 10.0 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 7/68 (10%) Frame = +2 Query: 86 VDAVFVERQKKVLSLFQDVDQVNVDDEYYK-------IGKDYDVEANIDXYTNKKAVEEF 244 VD V+ Q+K + +++ + +++ Y+ I K E + Y NK +EF Sbjct: 651 VDRVYRIGQEKNVIIYRLITSCTIEERIYEKQVSKEGIFKAATEERDFRRYINKLGYKEF 710 Query: 245 LKLYRIGY 268 LKL +G+ Sbjct: 711 LKLPEMGF 718 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,636,050 Number of Sequences: 37544 Number of extensions: 216966 Number of successful extensions: 497 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 489 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 497 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 943260316 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -