BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_F01 (502 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1672.11c |||P-type ATPase |Schizosaccharomyces pombe|chr 3||... 26 3.7 SPAC19A8.11c |||recombination protein Irc6 |Schizosaccharomyces ... 25 4.8 SPCC965.04c |||mitochondrial inner membrane i-AAA protease compl... 25 6.4 SPCC736.11 |ago1|csp9|argonaute|Schizosaccharomyces pombe|chr 3|... 25 8.4 SPAC1A6.02 ||SPAC23C4.21|WD repeat protein, human WDR55 family|S... 25 8.4 >SPCC1672.11c |||P-type ATPase |Schizosaccharomyces pombe|chr 3|||Manual Length = 1315 Score = 25.8 bits (54), Expect = 3.7 Identities = 12/51 (23%), Positives = 26/51 (50%) Frame = +3 Query: 36 EYFIEHLSQNISSLKIQIALHTLYILKSLYLFNYNLFGKFMKKTCLLILTI 188 E I+ +++S L I LH YI + + +++ + C+LI+++ Sbjct: 312 ENLIDLELKSVSQLLIDEVLHPFYIFQVFSIILWSMDSYYYYAICILIISV 362 >SPAC19A8.11c |||recombination protein Irc6 |Schizosaccharomyces pombe|chr 1|||Manual Length = 246 Score = 25.4 bits (53), Expect = 4.8 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +1 Query: 334 ILFIGDSVTGRLPSGKLLSGSFPTG 408 IL IG S +G+L K L+GS P G Sbjct: 4 ILVIGRSNSGKLDFIKALTGSLPKG 28 >SPCC965.04c |||mitochondrial inner membrane i-AAA protease complex subunit Yme1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 709 Score = 25.0 bits (52), Expect = 6.4 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 361 GRLPSGKLLSGSFPTGRMLFGKFLTGK 441 G+LP G LL+G TG+ + + + G+ Sbjct: 297 GKLPRGVLLTGPPGTGKTMLARAVAGE 323 >SPCC736.11 |ago1|csp9|argonaute|Schizosaccharomyces pombe|chr 3|||Manual Length = 834 Score = 24.6 bits (51), Expect = 8.4 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +3 Query: 228 INRDAEKVSTCCPS-SLLYNPRRLSCSTTK 314 IN + ++ C S S YNP+ L C+T K Sbjct: 662 INDELSQIKEACHSLSPKYNPKILVCTTQK 691 >SPAC1A6.02 ||SPAC23C4.21|WD repeat protein, human WDR55 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 361 Score = 24.6 bits (51), Expect = 8.4 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +1 Query: 319 LGSNGILFIGDSVTGRLPS 375 +GS+G+L I D+ TGR+ S Sbjct: 77 VGSDGVLKIADTSTGRVSS 95 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,788,684 Number of Sequences: 5004 Number of extensions: 34495 Number of successful extensions: 85 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 198176188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -