BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_E21 (439 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13671| Best HMM Match : RVT_1 (HMM E-Value=1.8e-11) 30 0.73 SB_36447| Best HMM Match : Trp_repressor (HMM E-Value=2.5) 29 1.3 SB_23483| Best HMM Match : Glyco_hydro_38C (HMM E-Value=0) 29 2.2 SB_38379| Best HMM Match : GspM (HMM E-Value=1.4) 28 3.9 SB_46239| Best HMM Match : Phage_integrase (HMM E-Value=0.24) 28 3.9 SB_25880| Best HMM Match : Colipase_C (HMM E-Value=5.1) 28 3.9 SB_16137| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 >SB_13671| Best HMM Match : RVT_1 (HMM E-Value=1.8e-11) Length = 1702 Score = 30.3 bits (65), Expect = 0.73 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +1 Query: 34 SPSSRHLFLTAQLRRLQSTLVLAEHNNEVLSPATQNALTAAKKIGGEI 177 +P+S H FL A L +++ L+L + + P TQ A+ + E+ Sbjct: 509 TPNSNHWFLLAVLPHMKAVLLLDSRAVDYVKPPTQKAMNKMASVLSEL 556 >SB_36447| Best HMM Match : Trp_repressor (HMM E-Value=2.5) Length = 228 Score = 29.5 bits (63), Expect = 1.3 Identities = 28/90 (31%), Positives = 42/90 (46%), Gaps = 7/90 (7%) Frame = +1 Query: 55 FLTAQLRRLQSTLVLAE--HNN---EVLSPATQNALTAAKKIGGEISVLVVGTKCGPAAD 219 FL RRL ++V+A H N E+L P +Q + K GE+ L V A D Sbjct: 134 FLEFLDRRLDKSIVIAYKIHVNTVKEILPPFSQKYIDRMKAAQGEVKYLEVAKYYSSAMD 193 Query: 220 KIAKANGVAKV--LVAESDAFKGFTAESIT 303 A + GV + L+ +DA G++ + T Sbjct: 194 -TAVSIGVPLISTLMPAADALTGYSKKKTT 222 >SB_23483| Best HMM Match : Glyco_hydro_38C (HMM E-Value=0) Length = 965 Score = 28.7 bits (61), Expect = 2.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 337 FYPYLGSRYCFWQGYF 384 F+PY +C+W GYF Sbjct: 298 FFPYADCPHCYWTGYF 313 >SB_38379| Best HMM Match : GspM (HMM E-Value=1.4) Length = 697 Score = 27.9 bits (59), Expect = 3.9 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = -2 Query: 222 LVCSWTTFCTDYKHRYLTANFLS 154 L WT+FC+D +H ++T+ + + Sbjct: 99 LFALWTSFCSDLQHLFITSYYFN 121 >SB_46239| Best HMM Match : Phage_integrase (HMM E-Value=0.24) Length = 364 Score = 27.9 bits (59), Expect = 3.9 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 6/66 (9%) Frame = +1 Query: 214 ADKIAKANGVAKVLVAE-----SDAFKGFTAESITPLILATQKQL-*FYPYLGSRYCFWQ 375 A +A NG++ L+ SDA+KG+ + L A+ +Q+ + +G+ +C W Sbjct: 248 AATVAARNGLSDHLIQSLVRWSSDAYKGYIRTPVEALAAASAEQIPPVHSVVGAWFC-W- 305 Query: 376 GYFAEG 393 GYF+ G Sbjct: 306 GYFSYG 311 >SB_25880| Best HMM Match : Colipase_C (HMM E-Value=5.1) Length = 172 Score = 27.9 bits (59), Expect = 3.9 Identities = 13/49 (26%), Positives = 20/49 (40%) Frame = -3 Query: 158 LAAVSAFWVAGDNTSLLCSAKTNVLCKRRSCAVKNRCLLLGENIFQCFF 12 + +AFW G C+ + + C +K RC L F C+F Sbjct: 85 MTETAAFWYPGKE----CNTADDCIWPNTCCILKKRCSLKLPKYFTCYF 129 >SB_16137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 26.6 bits (56), Expect = 8.9 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 148 TAAKKIGGEISVLVVGTKCGPAADKIAKAN 237 +AA +IG ISVL+V K + ++A AN Sbjct: 15 SAAVRIGSTISVLIVINKLCKSGKRVASAN 44 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,818,284 Number of Sequences: 59808 Number of extensions: 224569 Number of successful extensions: 610 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 610 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 847047381 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -