BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_E19 (424 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50471-1|AAA93474.1| 135|Anopheles gambiae protein ( Anopheles ... 169 5e-44 AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 26 0.65 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 26 0.65 AF515522-1|AAM61889.1| 222|Anopheles gambiae glutathione S-tran... 25 1.1 >U50471-1|AAA93474.1| 135|Anopheles gambiae protein ( Anopheles gambiae putativeribosomal protein S8 mRNA, complete cds. ). Length = 135 Score = 169 bits (410), Expect = 5e-44 Identities = 75/114 (65%), Positives = 98/114 (85%) Frame = +1 Query: 1 ELVRTKTLVKNAIVVVDATPFRQWYESHYLLPLGRKKGAKLTEAEEAIINKKRSQKTAKK 180 EL+RTKTLVKNAI+V+DA+PFRQWYESHYLLPLG+K+ +L EE +++KKR++ +K Sbjct: 18 ELIRTKTLVKNAIIVIDASPFRQWYESHYLLPLGKKR--ELKAGEEDVLSKKRTKSNLRK 75 Query: 181 YLSRQRLSKVEGGLEEQFHTGRLLACVASRPGQCGRADXYILEGKELEFYLRKI 342 Y+ RQ+ +K++ +EEQF+ GRLLAC++SRPGQ GRAD YILEGKELEFYL+KI Sbjct: 76 YVKRQKNAKIDPAVEEQFNAGRLLACISSRPGQVGRADGYILEGKELEFYLKKI 129 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 25.8 bits (54), Expect = 0.65 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = -2 Query: 210 YLGQALPAQVLLRCLLTAFFVYDGFLSLSELGTFLPSEWQQVVAFI 73 + G ++P + LL C A F+++ ++ L E T L + V F+ Sbjct: 348 FCGDSIPQRALLSCAFGAVFIFN-YIPLQEGTTRLRYTFFYAVCFV 392 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 25.8 bits (54), Expect = 0.65 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 47 WMPHLSGSGMKATTCCHSEGRKVPS 121 W+PH+ +KAT H+ R +P+ Sbjct: 819 WVPHVKEITLKATRIVHAVNRLMPN 843 >AF515522-1|AAM61889.1| 222|Anopheles gambiae glutathione S-transferase protein. Length = 222 Score = 25.0 bits (52), Expect = 1.1 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +1 Query: 313 KELEFYLRKIXIXRGGKADMCNNIQEINFKKQ 408 KE+ + ++ I + + G CN +E+N +Q Sbjct: 33 KEIPYDIKPISLIKSGGEQHCNEYREVNPMEQ 64 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.317 0.134 0.381 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 457,475 Number of Sequences: 2352 Number of extensions: 9633 Number of successful extensions: 17 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 35060166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -