BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_E16 (555 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 4.8 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 4.8 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 4.8 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 21 6.3 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 6.3 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 21 6.3 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 8.4 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 21 8.4 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.8 bits (44), Expect = 4.8 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -3 Query: 475 DPVFDALFGCQYVICSFQHN 416 DP+FD VIC H+ Sbjct: 212 DPIFDKKAMSDLVICKLSHS 231 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.8 bits (44), Expect = 4.8 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -3 Query: 475 DPVFDALFGCQYVICSFQHN 416 DP+FD VIC H+ Sbjct: 212 DPIFDKKAMSDLVICKLSHS 231 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 4.8 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -1 Query: 468 YSTRFLVASTXSAVSNITRSL 406 +S + +VAS+ S V+N+T +L Sbjct: 943 HSAQSVVASSASNVTNVTTNL 963 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.3 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 70 YGKSRKEIRKNSKATI*RRKYVERSPQ 150 Y +SR+ +K+ K RKY ERS + Sbjct: 39 YSRSREREQKSYKNERKYRKYRERSKE 65 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.4 bits (43), Expect = 6.3 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 70 YGKSRKEIRKNSKATI*RRKYVERSPQ 150 Y +SR+ +K+ K RKY ERS + Sbjct: 39 YSRSREREQKSYKNERKYRKYRERSKE 65 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 21.4 bits (43), Expect = 6.3 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = -2 Query: 404 YLVFEPRYEVIHSYARC 354 Y ++ PRY + +S ++C Sbjct: 54 YYIYNPRYPLPYSGSKC 70 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.0 bits (42), Expect = 8.4 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -2 Query: 332 VCFLVSDCAECLRWSLPDDHPSLVTSLLFY 243 +C ++ C L W LP + + LL+Y Sbjct: 292 ICHIL--CMSDLHWQLPHNSTNPPNILLYY 319 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 21.0 bits (42), Expect = 8.4 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 197 TTGIENIRQNDEN 235 TTG+EN R N+ N Sbjct: 10 TTGLENWRVNNSN 22 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,481 Number of Sequences: 438 Number of extensions: 3404 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15949830 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -