BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_E15 (656 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 22 5.1 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 21 6.7 AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory recept... 21 6.7 AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esteras... 21 8.9 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 322 IEHLLANP*QVVVRRRIL 269 IEH L++P Q V+ R+L Sbjct: 127 IEHKLSDPNQCVICHRVL 144 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 21.4 bits (43), Expect = 6.7 Identities = 10/39 (25%), Positives = 17/39 (43%) Frame = +2 Query: 293 LLRISEEMFNADINNAFNYIQVSLQGKTSPMSKNDEASS 409 +L+I + N INN Y Q + G N + ++ Sbjct: 463 MLKIRFVILNKQINNLIEYFQKNKIGPVETKGTNKQLNT 501 >AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory receptor candidate 24 protein. Length = 384 Score = 21.4 bits (43), Expect = 6.7 Identities = 10/39 (25%), Positives = 17/39 (43%) Frame = +2 Query: 293 LLRISEEMFNADINNAFNYIQVSLQGKTSPMSKNDEASS 409 +L+I + N INN Y Q + G N + ++ Sbjct: 188 MLKIRFVILNKQINNLIEYFQKNKIGPVETKGTNKQLNT 226 >AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.0 bits (42), Expect = 8.9 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 38 MRIILILLVSLGLCHADDIAQ 100 MR++ L + L LCHA+ I + Sbjct: 1 MRVVP-LAIFLALCHAEPIVE 20 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,691 Number of Sequences: 336 Number of extensions: 2828 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -