BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_E15 (656 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK222496-1|BAD96216.1| 564|Homo sapiens eukaryotic translation ... 31 4.8 >AK222496-1|BAD96216.1| 564|Homo sapiens eukaryotic translation initiation factor 3 subunit 6 interacting protein varian protein. Length = 564 Score = 30.7 bits (66), Expect = 4.8 Identities = 26/122 (21%), Positives = 51/122 (41%), Gaps = 2/122 (1%) Frame = +2 Query: 293 LLRISEEMFNADINNAFNY-IQVSLQGKTSPMSKND-EASSNLLNVPENVWSGPTIRPFV 466 LL I+ M+ I+ + + ++ K M K D + L + + P + + Sbjct: 370 LLAIALTMYPMRIDESIHLQLREKYGDKMLRMQKGDPQVYEELFSYSCPKFLSPVVPNYD 429 Query: 467 ALFDNYHKNVIRPEFVTPNEETEQTTYINTILATGPIRTLMNFLVSKGLTHMNEYXEQVQ 646 ++ NYHK + ++E +Q ++TI + + T M G + E ++Q Sbjct: 430 NVYPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQ 489 Query: 647 LL 652 LL Sbjct: 490 LL 491 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,945,069 Number of Sequences: 237096 Number of extensions: 1673002 Number of successful extensions: 3168 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3071 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3164 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7366354010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -