BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_E14 (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory recept... 22 2.9 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 22 3.8 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 21 8.7 AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esteras... 21 8.7 AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 21 8.7 >AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory receptor candidate 24 protein. Length = 384 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/42 (26%), Positives = 19/42 (45%) Frame = -3 Query: 285 YQKFIHIFRVLCKCHEGFMFVSIRERNVEFNKCCIKFTNNFI 160 YQKF++ R+L F V+ +F ++F N + Sbjct: 8 YQKFVNSIRILLFQSRIFGLVTFTPDRSKFRPSSLRFCLNIL 49 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.8 bits (44), Expect = 3.8 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -2 Query: 313 HRNLSRRLRLSKVHPHISRPLQVPRRL 233 H + + L K HPHI P V + L Sbjct: 77 HLRIYQTLLSGKNHPHIQLPKHVDQYL 103 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 20.6 bits (41), Expect = 8.7 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -2 Query: 316 FHRNLSRRLRLSKVHPHISRPLQVPR 239 F NLS R++ ++ S L++P+ Sbjct: 157 FGDNLSERMKTTRALEKTSEELKIPK 182 >AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 20.6 bits (41), Expect = 8.7 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = -3 Query: 204 VEFNKCCIKFTNNFIER*FI*FHG 133 + K C K NF + F FHG Sbjct: 8 ISTGKLCGKVGKNFNNKAFFCFHG 31 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 20.6 bits (41), Expect = 8.7 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = -3 Query: 204 VEFNKCCIKFTNNFIER*FI*FHG 133 + K C K NF + F FHG Sbjct: 8 ISTGKLCGKVGKNFNNKAFFCFHG 31 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,116 Number of Sequences: 336 Number of extensions: 2073 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -