BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_E14 (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 26 0.67 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 24 2.7 CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine... 23 8.2 AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase p... 23 8.2 AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. 23 8.2 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 26.2 bits (55), Expect = 0.67 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 4/58 (6%) Frame = +1 Query: 133 SVELDELSFNKVISKFDAALVKFDV----AFPYGDKHEAFVALAKDAKYVDELLIAEV 294 S L +++ + AAL F AFP+ D H+ ++A++A + L +A V Sbjct: 4 SFNLSTVTYELISGNVSAALENFTASMAGAFPFEDLHDPASSIARNASFTLGLGLANV 61 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 24.2 bits (50), Expect = 2.7 Identities = 15/58 (25%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Frame = +1 Query: 133 SVELDELSFNKVISKFDAALVKFDV----AFPYGDKHEAFVALAKDAKYVDELLIAEV 294 S L +++ + AAL F AFP+ D H+ + A++A + + +A V Sbjct: 4 SFNLSTVTYELIWGNVSAALENFTASMAGAFPFEDLHDPASSFARNASFTLGMGLANV 61 >CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine-phosphate lyase protein. Length = 519 Score = 22.6 bits (46), Expect = 8.2 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +1 Query: 133 SVELDELSFNKVISKFDAALVKFDVAFPYG--DKHEAFVALAK 255 + E+D + + I++ LV FPYG D EA AL + Sbjct: 224 TTEVDIAAMERAINRNTVMLVGSAPNFPYGTMDDIEAIAALGR 266 >AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase protein. Length = 557 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +1 Query: 397 SEPISFNDAKGFTTDELRRFVRENTGLYLSLPGCVRDLDK 516 +E I+F+D+ +E + + + L L C ++DK Sbjct: 197 TESITFSDSVAAVREEAAALKKRDVNIILVLSHCGLEVDK 236 >AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. Length = 557 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +1 Query: 397 SEPISFNDAKGFTTDELRRFVRENTGLYLSLPGCVRDLDK 516 +E I+F+D+ +E + + + L L C ++DK Sbjct: 197 TESITFSDSVAAVREEAAALKKRDVNIILVLSHCGLEVDK 236 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 493,029 Number of Sequences: 2352 Number of extensions: 8256 Number of successful extensions: 18 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -