BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_E11 (505 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0711 - 26508228-26508488,26508970-26509084,26509179-265094... 29 1.6 09_02_0118 - 4451228-4452565 29 2.8 12_02_0491 + 19648754-19650021,19650135-19650248,19650871-196514... 28 4.9 10_07_0133 + 13274190-13274317,13274533-13276371,13277064-132772... 27 6.5 03_02_1008 - 13170630-13171481 27 6.5 03_06_0177 + 32163393-32163443,32163711-32163803,32163875-321640... 27 8.6 02_04_0335 + 22117902-22119869 27 8.6 >11_06_0711 - 26508228-26508488,26508970-26509084,26509179-26509451, 26509629-26510197,26510489-26510597,26511002-26511544, 26511645-26511763,26511893-26512120,26512199-26512315, 26512410-26512506,26513169-26513569 Length = 943 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 5/43 (11%) Frame = -1 Query: 370 SLYLALTWGRPFWWRAISHILP*IIIR-----PSDLA*PCLPF 257 S+ L L+W +PFW+ +SH I +R S L PC P+ Sbjct: 504 SVILPLSWVKPFWFYLVSHGAHAIGLRERRWIASKLKMPCFPY 546 >09_02_0118 - 4451228-4452565 Length = 445 Score = 28.7 bits (61), Expect = 2.8 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 304 MAEYEILPSTKMDVPTLTRDTMTDSLRRYSP 396 MA +LP V LT DT+ D LRR +P Sbjct: 1 MASETLLPPPTTTVAALTDDTLLDILRRLAP 31 >12_02_0491 + 19648754-19650021,19650135-19650248,19650871-19651427, 19651446-19651529,19651566-19651783,19652004-19652309 Length = 848 Score = 27.9 bits (59), Expect = 4.9 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -2 Query: 246 ISTSAGRLSHYETFYQAEHCMGMCRGTGVSV 154 IST+ G+L+ +ET +AEH + R V + Sbjct: 501 ISTARGKLTCHETILEAEHSLETIRNGDVGI 531 >10_07_0133 + 13274190-13274317,13274533-13276371,13277064-13277253, 13277442-13277657 Length = 790 Score = 27.5 bits (58), Expect = 6.5 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 190 LHGNVPRHRSLRLEMDLQCHPLC 122 LHGN+ ++ +L M + CH C Sbjct: 695 LHGNLGNQKARQLRMKISCHEQC 717 >03_02_1008 - 13170630-13171481 Length = 283 Score = 27.5 bits (58), Expect = 6.5 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = -3 Query: 293 PTK*PSVTVFAILEVTSRHLQGDSHITKRSTRRSTAWECAEAP 165 P S+ +++T RHL GDSH + E E P Sbjct: 162 PATQSSIDAMPTVKITQRHLSGDSHCPVCKDKFELGSEAREMP 204 >03_06_0177 + 32163393-32163443,32163711-32163803,32163875-32164071, 32164157-32164262,32164391-32164537,32164637-32164756 Length = 237 Score = 27.1 bits (57), Expect = 8.6 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -1 Query: 301 IIIRPSDLA*PCLPFWK*HLDICRATLTLRNVLPGGALHGNV 176 ++ P+ A C+PFWK L AT T+ L GG L G V Sbjct: 136 LVFPPTATAILCVPFWK--LVAFFATPTITPALFGGGLLGYV 175 >02_04_0335 + 22117902-22119869 Length = 655 Score = 27.1 bits (57), Expect = 8.6 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = -1 Query: 220 TLRNVLPGGALHGNVPRHRSLRLEMDLQCHPLCCVY*VSITVRSDETTKITN 65 T V GGA HG+ R +L + + P + S V SD T +TN Sbjct: 192 TDNTVSGGGARHGHARRRVVRQLSPEPEPEPSATMTETSFGVSSDVVTTVTN 243 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,704,071 Number of Sequences: 37544 Number of extensions: 284778 Number of successful extensions: 630 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1071221400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -