BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_E06 (604 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 23 2.3 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 4.0 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 5.3 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 7.0 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 9.3 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 Query: 188 DGLTSVYKSNVD 223 DGLTSVY+ VD Sbjct: 118 DGLTSVYRMQVD 129 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.2 bits (45), Expect = 4.0 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +3 Query: 57 IMKVIEYSPSITIRMC-CPQLKNRRHLKRICS 149 I K E SP+ TI +C C + RRH + +C+ Sbjct: 89 IGKECELSPNSTIAVCVCMRKCPRRH-RPVCA 119 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.8 bits (44), Expect = 5.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 241 DDIKE*IHITFVDTGQSVQHY 179 D I E + T +D G S+QHY Sbjct: 51 DIIPEQKNATKIDFGLSIQHY 71 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.4 bits (43), Expect = 7.0 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = +3 Query: 48 ASWIMKVIEYSPSITIRMCCP 110 + W KVI+ + + + CCP Sbjct: 215 SKWDFKVIKATKVLKMYACCP 235 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.0 bits (42), Expect = 9.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 188 DGLTSVYKSNVD 223 DGLTSV++ VD Sbjct: 243 DGLTSVFRIQVD 254 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,329 Number of Sequences: 438 Number of extensions: 2980 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17726685 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -