BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_E04 (494 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC31F10.13c |hip1|hir1|hira protein Hip1|Schizosaccharomyces p... 29 0.51 SPCC1672.09 |||triglyceride lipase-cholesterol esterase |Schizos... 25 8.3 >SPBC31F10.13c |hip1|hir1|hira protein Hip1|Schizosaccharomyces pombe|chr 2|||Manual Length = 932 Score = 28.7 bits (61), Expect = 0.51 Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = -1 Query: 494 HIFETTQQCWLMVNGKWWAYFCR--DASG*IMS 402 +++ +T CW + WWA R D+SG + S Sbjct: 757 YVYSSTMLCWQRITEPWWAIGSREWDSSGLLQS 789 >SPCC1672.09 |||triglyceride lipase-cholesterol esterase |Schizosaccharomyces pombe|chr 3|||Manual Length = 467 Score = 24.6 bits (51), Expect = 8.3 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = +2 Query: 176 SDGTSGAMVKV---PILETKITSSVLLAPLIS 262 S GT+ A + P+L KI S + LAP IS Sbjct: 222 SQGTAQAFASLSIHPLLNDKINSLIALAPAIS 253 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,991,305 Number of Sequences: 5004 Number of extensions: 37326 Number of successful extensions: 75 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 194131776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -