BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_E03 (557 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 1.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 4.1 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 21 7.2 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 9.5 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 23.0 bits (47), Expect = 1.8 Identities = 17/62 (27%), Positives = 27/62 (43%) Frame = +1 Query: 262 NAVNAESVDKPAFQESSFASVPVYDISNVRPGTVALQSLPSPQLTADTSYQYQPLSIPAY 441 +A+ DK + + A P IS + T+A+Q+ P LT YQ+ P Y Sbjct: 121 SALQRARADKTYRRSYTHAKPPYSYISLI---TMAIQNSPQKMLTLSEIYQFIMDLFPFY 177 Query: 442 NR 447 + Sbjct: 178 RQ 179 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 4.1 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -2 Query: 55 QERGPSVSCQNVSWYIHR 2 +E GP V C +W +R Sbjct: 633 KEEGPKVVCYMTNWAFYR 650 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 21.0 bits (42), Expect = 7.2 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +1 Query: 361 VALQSLPSPQLTADTSYQYQPLSIPAY--NRFGGDPSYSTNSVSGFKC 498 +A+++ P +LT + Y+Y + P Y N+ G S N +S KC Sbjct: 94 MAIRNSPEKRLTLNGIYEYIMRNFPYYRENKQGWQNSIRHN-LSLNKC 140 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 421 PLSIPAYNRFGGDPSYSTNSV 483 P S+P +P+YS+ SV Sbjct: 81 PSSLPTQRTSTSNPTYSSRSV 101 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,472 Number of Sequences: 336 Number of extensions: 2910 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13681771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -