BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_E02 (569 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1058 + 23631819-23631943,23632032-23632101,23632196-236333... 29 2.6 05_03_0424 - 13795721-13795900,13796134-13796202,13796260-137963... 27 8.0 >07_03_1058 + 23631819-23631943,23632032-23632101,23632196-23633368, 23633469-23634266 Length = 721 Score = 29.1 bits (62), Expect = 2.6 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = -2 Query: 121 PPVNQNAGKESMRGPREIRCVERRARQHVAVQQVEHGAHA 2 P Q+AG +S+ G E+R +E HV++Q+ GA A Sbjct: 369 PEPEQDAGGQSIAGSPEVRAMESIVASHVSMQR--RGAEA 406 >05_03_0424 - 13795721-13795900,13796134-13796202,13796260-13796385, 13797224-13798166,13798263-13799248 Length = 767 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 38 VLPRATLDAPDLARAAHRLLASVLIN 115 +L A AP LARAAH LL + +N Sbjct: 159 LLAAARYPAPSLARAAHALLGKIGLN 184 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,774,525 Number of Sequences: 37544 Number of extensions: 133792 Number of successful extensions: 391 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 387 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 391 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1317005676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -