BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_E02 (569 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 4.9 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 6.5 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 21 8.6 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.8 bits (44), Expect = 4.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 240 DSTLKPSTRSITSVNST 290 D K S SITSVNST Sbjct: 398 DEDQKCSIESITSVNST 414 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.4 bits (43), Expect = 6.5 Identities = 9/35 (25%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -2 Query: 295 LMVEFTLVIERVEGFNVESQQF--DIWLQERAAES 197 ++V+F + + + NVE F D+++++ ES Sbjct: 11 VLVDFNIFVADINSINVEDMDFRVDMFVRQSWIES 45 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 485 PIHLRHLENFPPDTDLPT 538 P H + +E+FP LPT Sbjct: 141 PFHEKLVESFPRGGSLPT 158 Score = 21.0 bits (42), Expect = 8.6 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +2 Query: 254 TLDTLNNKCKLYHK 295 TL++LNN +YH+ Sbjct: 413 TLNSLNNHKSIYHR 426 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,869 Number of Sequences: 438 Number of extensions: 1241 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -