BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_D22 (561 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1289.13c |||alpha-1,2-galactosyltransferase|Schizosaccharomy... 27 1.9 SPAC1039.09 |isp5||amino acid permease Isp5|Schizosaccharomyces ... 27 1.9 >SPBC1289.13c |||alpha-1,2-galactosyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 375 Score = 27.1 bits (57), Expect = 1.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -2 Query: 335 LYIFHEIKVVERQGQFRKLKSHPIYNKHIVII 240 LY H VE+Q + SHPI +KH+ ++ Sbjct: 273 LYKEHNGVFVEQQALSHMIYSHPIVHKHVGLV 304 >SPAC1039.09 |isp5||amino acid permease Isp5|Schizosaccharomyces pombe|chr 1|||Manual Length = 580 Score = 27.1 bits (57), Expect = 1.9 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -2 Query: 218 LRFYTLRFIVLSM*IMFI*KINNQGIW*NLSVA*LCFKSLPG 93 L Y L I S+ + F IN+ GIW + +A LCF ++ G Sbjct: 173 LATYPLELITASICLQFWININS-GIWITVFIALLCFVNMFG 213 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,044,052 Number of Sequences: 5004 Number of extensions: 37379 Number of successful extensions: 67 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 236012634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -