BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_D21 (451 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 1.0 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 1.0 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 3.1 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 20 9.4 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 23.4 bits (48), Expect = 1.0 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 441 HSVGVDVCLDWNGVW 397 H G +V L W+GVW Sbjct: 191 HIEGNEVTLHWHGVW 205 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 23.4 bits (48), Expect = 1.0 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 441 HSVGVDVCLDWNGVW 397 H G +V L W+GVW Sbjct: 191 HIEGNEVTLHWHGVW 205 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.8 bits (44), Expect = 3.1 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +2 Query: 272 PPRGGIPRMGSRIQNGYRIQYPLDNNYNFIAFIFP 376 PP I + IQN + L Y FI +FP Sbjct: 141 PPYSYISLITMAIQNSPQKMLTLSEIYQFIMDLFP 175 Score = 21.0 bits (42), Expect = 5.4 Identities = 9/21 (42%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = -3 Query: 350 NCCPKGIEFGNHS-EFGIPFG 291 NC P+G FG+ G+P G Sbjct: 41 NCSPQGASFGSSMLNSGMPGG 61 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 20.2 bits (40), Expect = 9.4 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +1 Query: 289 SPNGIPNSEWLPNSIP 336 SP G P+ P+S+P Sbjct: 70 SPQGAPSPSSTPSSLP 85 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,005 Number of Sequences: 336 Number of extensions: 1756 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -