BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_D21 (451 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68004-3|CAA91983.2| 380|Caenorhabditis elegans Hypothetical pr... 27 6.3 AF106576-2|AAC78180.1| 241|Caenorhabditis elegans Hypothetical ... 27 6.3 >Z68004-3|CAA91983.2| 380|Caenorhabditis elegans Hypothetical protein F47B10.3 protein. Length = 380 Score = 27.1 bits (57), Expect = 6.3 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +2 Query: 314 NGYRIQYPLDNNYNFIAFIFPNQVQFPNQTPFQSRQTSTPTL 439 N Y YP D + + P + F NQ+ F RQ P + Sbjct: 338 NMYPQAYPQDFQHQYQPLFVPVPMTFYNQSQFPMRQNEIPVV 379 >AF106576-2|AAC78180.1| 241|Caenorhabditis elegans Hypothetical protein W07E6.5 protein. Length = 241 Score = 27.1 bits (57), Expect = 6.3 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 291 PEWDPEFRMVTEFNTLWTTIIIL*PSFFLIKCSSQTKHRSSQ 416 P+WD + V F +L + SFF +KC S + +S+ Sbjct: 121 PKWDDYQKRVFNFCSLSIFSFVASTSFFSLKCHSPKHYSNSE 162 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,165,382 Number of Sequences: 27780 Number of extensions: 160825 Number of successful extensions: 390 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 382 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 390 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 788595652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -