BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_D21 (451 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 21 4.7 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 8.2 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 8.2 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 8.2 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 8.2 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 8.2 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 4.7 Identities = 10/39 (25%), Positives = 17/39 (43%) Frame = +2 Query: 290 PRMGSRIQNGYRIQYPLDNNYNFIAFIFPNQVQFPNQTP 406 P++ S + N Y +NNY + + + Q P P Sbjct: 79 PKIISSLSNNYNYSNYNNNNYKQLCYNINHIEQIPVPVP 117 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 343 QQL*FYSLHFXXXXAVPKPNTVPV 414 ++L +Y++++ VP P VPV Sbjct: 98 KKLQYYNINYIEQIPVPVPVPVPV 121 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 343 QQL*FYSLHFXXXXAVPKPNTVPV 414 ++L +Y++++ VP P VPV Sbjct: 98 KKLQYYNINYIEQIPVPVPVPVPV 121 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 343 QQL*FYSLHFXXXXAVPKPNTVPV 414 ++L +Y++++ VP P VPV Sbjct: 98 KKLQYYNINYIEQIPVPVPIPVPV 121 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 343 QQL*FYSLHFXXXXAVPKPNTVPV 414 ++L +Y++++ VP P VPV Sbjct: 98 KKLQYYNINYIEQIPVPVPVPVPV 121 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 343 QQL*FYSLHFXXXXAVPKPNTVPV 414 ++L +Y++++ VP P VPV Sbjct: 331 KKLQYYNINYIEQIPVPVPVPVPV 354 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,367 Number of Sequences: 438 Number of extensions: 2295 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -