BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_D21 (451 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g20730.1 68416.m02623 pentatricopeptide (PPR) repeat-containi... 27 4.4 At3g02330.1 68416.m00216 pentatricopeptide (PPR) repeat-containi... 27 4.4 >At3g20730.1 68416.m02623 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 564 Score = 27.5 bits (58), Expect = 4.4 Identities = 10/38 (26%), Positives = 21/38 (55%) Frame = +2 Query: 80 VRASYTGFYSQSGDLHEYKIQKADRKQREFIYWDKKRD 193 VR++ Y++ G + E ++Q K+R+ + W+ D Sbjct: 150 VRSALLSLYARCGKMEEARLQFDSMKERDLVSWNAMID 187 >At3g02330.1 68416.m00216 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 861 Score = 27.5 bits (58), Expect = 4.4 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +2 Query: 104 YSQSGDLHEYKIQKADRKQREFIYWD 181 YS+ GDLH+ ++ +R+F+ W+ Sbjct: 606 YSKCGDLHDSRLMFEKSLRRDFVTWN 631 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,467,164 Number of Sequences: 28952 Number of extensions: 141814 Number of successful extensions: 302 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 298 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 302 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 732537840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -