BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_D20 (502 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19800.1 68417.m02904 glycosyl hydrolase family 18 protein si... 36 0.020 At4g19730.1 68417.m02897 glycosyl hydrolase family 18 protein si... 34 0.062 At4g19810.1 68417.m02905 glycosyl hydrolase family 18 protein si... 33 0.11 At4g19750.1 68417.m02899 glycosyl hydrolase family 18 protein si... 33 0.14 At4g19770.1 68417.m02901 glycosyl hydrolase family 18 protein si... 31 0.33 At4g19720.1 68417.m02896 glycosyl hydrolase family 18 protein si... 31 0.33 At3g16460.2 68416.m02097 jacalin lectin family protein contains ... 31 0.58 At3g16460.1 68416.m02098 jacalin lectin family protein contains ... 31 0.58 At4g19740.1 68417.m02898 glycosyl hydrolase family 18 protein si... 30 0.76 At4g34350.1 68417.m04881 LytB family protein contains Pfam profi... 28 3.1 At4g25390.2 68417.m03653 protein kinase family protein contains ... 28 4.1 At4g25390.1 68417.m03652 protein kinase family protein contains ... 28 4.1 At2g46530.2 68415.m05803 transcriptional factor B3 family protei... 27 5.4 At2g46530.1 68415.m05802 transcriptional factor B3 family protei... 27 5.4 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 27 7.1 At5g57000.1 68418.m07114 expressed protein similar to unknown pr... 27 7.1 At4g20190.1 68417.m02952 hypothetical protein 27 7.1 At4g17880.1 68417.m02665 basic helix-loop-helix (bHLH) family pr... 27 7.1 At2g36730.1 68415.m04506 pentatricopeptide (PPR) repeat-containi... 27 7.1 At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein si... 27 9.4 >At4g19800.1 68417.m02904 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 398 Score = 35.5 bits (78), Expect = 0.020 Identities = 35/135 (25%), Positives = 52/135 (38%) Frame = +2 Query: 2 WIQNGAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEIC 181 W + G P K VLG G W L +D +++G GP G +SY ++ Sbjct: 220 WTEAGLPAKKAVLGFPYYGWAWTL-ADPDVNGY------DANTTGPAISDDGEISYRQLQ 272 Query: 182 AKLINPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDXGEGGFWVSYEDPDTAGNKASYVKT 361 +++ NG KV+D G Y + G W+ Y+ + K Y K Sbjct: 273 TWIVD---NG----ATKVHD-DMMVGDYCY-------AGTTWIGYDSEKSIVTKVIYAKQ 317 Query: 362 KNLGGVSIMDLSMDD 406 K L G + DD Sbjct: 318 KGLLGYFSWHVGGDD 332 >At4g19730.1 68417.m02897 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:505267 from [Nicotiana tabacum] Length = 332 Score = 33.9 bits (74), Expect = 0.062 Identities = 32/114 (28%), Positives = 46/114 (40%) Frame = +2 Query: 2 WIQNGAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEIC 181 WI++G P K VLG S G W L +D + +G A ++ G ++Y +I Sbjct: 235 WIKDGLPEKKAVLGFSYVGWAWTLQNDKD-TGYNAAAAGVAKSEDDVSE-DGSINYAQI- 291 Query: 182 AKLINPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDXGEGGFWVSYEDPDTAGNK 343 N+ + KV DP K G Y F W+ YED + K Sbjct: 292 ------NKFIRDEEAAKVYDP-KVVGHYCFAKK-------IWIGYEDTQSVEAK 331 >At4g19810.1 68417.m02905 glycosyl hydrolase family 18 protein similar to chitinase/lysozyme GI:467689 from [Nicotiana tabacum] Length = 379 Score = 33.1 bits (72), Expect = 0.11 Identities = 35/135 (25%), Positives = 49/135 (36%) Frame = +2 Query: 2 WIQNGAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEIC 181 WIQ G P K VLG G W+L + + S P G P G + Y +I Sbjct: 242 WIQAGLPAKKAVLGFPYYGYAWRLTNANSHSYYAP---TTGAAISP----DGSIGYGQIR 294 Query: 182 AKLINPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDXGEGGFWVSYEDPDTAGNKASYVKT 361 +++ NG S G Y + G W+ Y+D + K Y K Sbjct: 295 KFIVD---NGATTVYN-----STVVGDYCY-------AGTNWIGYDDNQSIVTKVRYAKQ 339 Query: 362 KNLGGVSIMDLSMDD 406 + L G + DD Sbjct: 340 RGLLGYFSWHVGADD 354 >At4g19750.1 68417.m02899 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 362 Score = 32.7 bits (71), Expect = 0.14 Identities = 34/125 (27%), Positives = 51/125 (40%) Frame = +2 Query: 2 WIQNGAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEIC 181 W++ P K VLG S G W L+ D+E +G G G ++Y +I Sbjct: 231 WLEAKLPAKKAVLGFSYCGWAWTLE-DAENNGY------DAATDGAAISSDGSITYAKIR 283 Query: 182 AKLINPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDXGEGGFWVSYEDPDTAGNKASYVKT 361 +I+ NG +DP+ G Y + G W+ Y+D + +K Y K Sbjct: 284 NYIID---NG----AATFHDPAV-IGFYCY-------VGTTWIGYDDNQSIVSKVRYAKL 328 Query: 362 KNLGG 376 K L G Sbjct: 329 KGLLG 333 >At4g19770.1 68417.m02901 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 261 Score = 31.5 bits (68), Expect = 0.33 Identities = 33/135 (24%), Positives = 47/135 (34%) Frame = +2 Query: 2 WIQNGAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEIC 181 WI G P K VLG G W L P H GP G +SY ++ Sbjct: 133 WIDAGLPAEKAVLGFPYYGWAWTLAD-------PKNHGYYVDTTGPAISDDGEISYSQLK 185 Query: 182 AKLINPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDXGEGGFWVSYEDPDTAGNKASYVKT 361 +++ V+D + G Y + G W+ Y+ ++ K Y K Sbjct: 186 TWIVDNKAT-------TVHD-NIVIGDYCY-------AGTTWIGYDSEESIVTKVIYAKQ 230 Query: 362 KNLGGVSIMDLSMDD 406 K L G + DD Sbjct: 231 KGLLGYFSWQVGGDD 245 >At4g19720.1 68417.m02896 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 363 Score = 31.5 bits (68), Expect = 0.33 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 2 WIQNGAPTHKLVLGISTTGRTWKLDSDSE 88 WI+ G P K VLG G TW L S ++ Sbjct: 230 WIKAGLPAKKAVLGFPYVGWTWSLGSGND 258 >At3g16460.2 68416.m02097 jacalin lectin family protein contains Pfam profile: PF01419 jacalin-like lectin domain; similar to myrosinase binding protein [Brassica napus] GI:1711296, GI:1655824, myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin family Length = 647 Score = 30.7 bits (66), Expect = 0.58 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 1/80 (1%) Frame = +2 Query: 14 GAPTHKL-VLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEICAKL 190 G+ KL G ST G +W D S+ GV I+A GGE Y K + L Sbjct: 249 GSGAQKLEAQGNSTGGTSW--DDGSDYDGVTKIYASYGGEGIQYVKFDYVKGGVTKQGVL 306 Query: 191 INPNQNGKRPHLRKVNDPSK 250 Q+ + P +N P + Sbjct: 307 HGKQQSRQNPREFVINHPDE 326 >At3g16460.1 68416.m02098 jacalin lectin family protein contains Pfam profile: PF01419 jacalin-like lectin domain; similar to myrosinase binding protein [Brassica napus] GI:1711296, GI:1655824, myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin family Length = 705 Score = 30.7 bits (66), Expect = 0.58 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 1/80 (1%) Frame = +2 Query: 14 GAPTHKL-VLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEICAKL 190 G+ KL G ST G +W D S+ GV I+A GGE Y K + L Sbjct: 249 GSGAQKLEAQGNSTGGTSW--DDGSDYDGVTKIYASYGGEGIQYVKFDYVKGGVTKQGVL 306 Query: 191 INPNQNGKRPHLRKVNDPSK 250 Q+ + P +N P + Sbjct: 307 HGKQQSRQNPREFVINHPDE 326 >At4g19740.1 68417.m02898 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 289 Score = 30.3 bits (65), Expect = 0.76 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +2 Query: 2 WIQNGAPTHKLVLGISTTGRTWKLDSDSE 88 W++ G P K V G G +W LD D + Sbjct: 210 WLKAGLPEKKAVFGFPYVGWSWTLDDDKD 238 >At4g34350.1 68417.m04881 LytB family protein contains Pfam profile: PF02401 LytB protein Length = 466 Score = 28.3 bits (60), Expect = 3.1 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = +2 Query: 32 LVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEICAK 187 LV+G + T L SE G+P D GP K+ L Y E+ K Sbjct: 372 LVVGGWNSSNTSHLQEISEARGIPSYWIDSEKRIGPGNKIAYKLHYGELVEK 423 >At4g25390.2 68417.m03653 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 497 Score = 27.9 bits (59), Expect = 4.1 Identities = 17/62 (27%), Positives = 30/62 (48%) Frame = +2 Query: 194 NPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDXGEGGFWVSYEDPDTAGNKASYVKTKNLG 373 N + + +RP R+ + S R T +F + G+GGF V + + G + VK + G Sbjct: 74 NASSSPRRPSPREFSYSSLRRATGSFSQANRLGQGGFGVVFRGTISGGENVA-VKVMDSG 132 Query: 374 GV 379 + Sbjct: 133 SL 134 >At4g25390.1 68417.m03652 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 651 Score = 27.9 bits (59), Expect = 4.1 Identities = 17/62 (27%), Positives = 30/62 (48%) Frame = +2 Query: 194 NPNQNGKRPHLRKVNDPSKRFGTYAFRLPDDXGEGGFWVSYEDPDTAGNKASYVKTKNLG 373 N + + +RP R+ + S R T +F + G+GGF V + + G + VK + G Sbjct: 74 NASSSPRRPSPREFSYSSLRRATGSFSQANRLGQGGFGVVFRGTISGGENVA-VKVMDSG 132 Query: 374 GV 379 + Sbjct: 133 SL 134 >At2g46530.2 68415.m05803 transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related contains Pfam profiles: PF02309 AUX/IAA family, PF02362 B3 DNA binding domain Length = 514 Score = 27.5 bits (58), Expect = 5.4 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +3 Query: 171 QKFAPNLLTPTKTESVLIFVRSTILANVLG-PMPSAFL 281 + F+P+ LTPT T+ RS ++ + G P+ S+FL Sbjct: 263 EPFSPSALTPTPTQQQSKSKRSRPISEITGSPVASSFL 300 >At2g46530.1 68415.m05802 transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related contains Pfam profiles: PF02309 AUX/IAA family, PF02362 B3 DNA binding domain Length = 601 Score = 27.5 bits (58), Expect = 5.4 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +3 Query: 171 QKFAPNLLTPTKTESVLIFVRSTILANVLG-PMPSAFL 281 + F+P+ LTPT T+ RS ++ + G P+ S+FL Sbjct: 350 EPFSPSALTPTPTQQQSKSKRSRPISEITGSPVASSFL 387 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 27.1 bits (57), Expect = 7.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 194 NPNQNGKRPHLRKVNDPSKRFGTYA 268 NPN N +R + K D S FG+YA Sbjct: 44 NPNPNFERSNSSKQCDDSSEFGSYA 68 >At5g57000.1 68418.m07114 expressed protein similar to unknown protein (gb|AAF21159.1) Length = 187 Score = 27.1 bits (57), Expect = 7.1 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 320 LRKKPRSHLHHXHQE 276 L++KP HLHH H+E Sbjct: 87 LKEKPPRHLHHHHKE 101 >At4g20190.1 68417.m02952 hypothetical protein Length = 389 Score = 27.1 bits (57), Expect = 7.1 Identities = 16/74 (21%), Positives = 28/74 (37%) Frame = -1 Query: 385 DGHTAKVLCFHVTSFVSGRVRIFVRNPEATFTXIIRKAEGIGPKTFARIVDLTKMRTLSV 206 DG LC ++ F G+ R +++FT R ++ AR + LS Sbjct: 208 DGFKCSALCLYLPGFSKGKPVRSSRKGDSSFT---RTTTMTSSQSMARTASIRDTAVLSA 264 Query: 205 LVGVNKFGANFWVA 164 + +F W + Sbjct: 265 RASLERFECGSWTS 278 >At4g17880.1 68417.m02665 basic helix-loop-helix (bHLH) family protein bHLH protein, Arabidopsis thaliana, PATCHX:E255557 Length = 589 Score = 27.1 bits (57), Expect = 7.1 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = +2 Query: 236 NDPSKRFGTYAFRLPDDXGEG--GFWVSYEDPDTAGNKASYVKTKNLGG 376 N+ FG++AF L D GE G W+S +P+ + N GG Sbjct: 253 NNGGGEFGSWAFNLNPDQGENDPGLWIS--EPNGVDSGLVAAPVMNNGG 299 >At2g36730.1 68415.m04506 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 501 Score = 27.1 bits (57), Expect = 7.1 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -1 Query: 271 EGIGPKTFARIVDLTKMRTLSVLVGVNKFG-ANFW 170 EGIG K R+++L R+ ++++ N+F A W Sbjct: 401 EGIGEKVKKRLIELEPKRSGNLVIVANRFAEARMW 435 >At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein similar to chitinase/lysozyme GI:467689 from [Nicotiana tabacum] Length = 366 Score = 26.6 bits (56), Expect = 9.4 Identities = 18/59 (30%), Positives = 24/59 (40%) Frame = +2 Query: 2 WIQNGAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGEAGPYTKVQGLLSYPEI 178 W Q G P K VLG G W L +D++ H +GP G + Y +I Sbjct: 240 WTQAGLPAKKAVLGFPLYGYAWCL-TDAK------NHNYYANSSGPAISPDGSIGYDQI 291 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,306,795 Number of Sequences: 28952 Number of extensions: 276272 Number of successful extensions: 744 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 743 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 888318720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -